mirror of
https://github.com/doublecmd/doublecmd.git
synced 2026-06-21 09:58:13 +00:00
12712 lines
337 KiB
Text
12712 lines
337 KiB
Text
msgid ""
|
|
msgstr ""
|
|
"Project-Id-Version: Double Commander 0.5.5 alpha\n"
|
|
"Report-Msgid-Bugs-To: \n"
|
|
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
|
|
"PO-Revision-Date: 2017-02-20 23:52-0300\n"
|
|
"Last-Translator: José Carlos Taveira <taveirajc@gmail.com>\n"
|
|
"Language-Team: José Carlos Taveira <taveirajc@gmail.com>\n"
|
|
"Language: pt_BR\n"
|
|
"MIME-Version: 1.0\n"
|
|
"Content-Type: text/plain; charset=UTF-8\n"
|
|
"Content-Transfer-Encoding: 8bit\n"
|
|
"Plural-Forms: nplurals=2; plural=(n > 1);\n"
|
|
"X-Generator: Poedit 1.8.12\n"
|
|
"X-Native-Language: Português do Brasil\n"
|
|
|
|
#: fsyncdirsdlg.rscomparingpercent
|
|
msgid "Comparing... %d%% (ESC to cancel)"
|
|
msgstr "Comparando... %d%% (ESC para cancelar)."
|
|
|
|
#: fsyncdirsdlg.rsdeleteright
|
|
msgid "Right: Delete %d file(s)"
|
|
msgstr "Direito: Excluir %d arquivo(s)."
|
|
|
|
#: fsyncdirsdlg.rsfilesfound
|
|
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
|
|
msgstr "Arquivos encontrados: %d (Idênticos: %d, Diferentes: %d, Único esquerda: %d, Único direita: %d "
|
|
|
|
#: fsyncdirsdlg.rslefttorightcopy
|
|
msgid "Left to Right: Copy %d files, total size: %d bytes"
|
|
msgstr "Equerda para Direita: Copiar %d arquivos, tam total: %d bytes"
|
|
|
|
#: fsyncdirsdlg.rsrighttoleftcopy
|
|
msgid "Right to Left: Copy %d files, total size: %d bytes"
|
|
msgstr "Direita para Esquerda: Copiar %d arquivos, tam total: %d bytes"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
|
|
msgid "Choose template..."
|
|
msgstr "Escolher modelo..."
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
|
|
msgid "C&heck free space"
|
|
msgstr "&Verificar espaço livre"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
|
|
msgid "Cop&y attributes"
|
|
msgstr "Cop&iar atributos"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
|
|
msgid "Copy o&wnership"
|
|
msgstr "Copiar &propriedade"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
|
|
msgid "Copy &permissions"
|
|
msgstr "Copiar &permissões"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
|
|
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
|
|
msgid "Copy d&ate/time"
|
|
msgstr "Copiar d&ata/hora"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
|
|
msgid "Correct lin&ks"
|
|
msgstr "Corrigir lin&ks"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
|
|
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.CBDROPREADONLYFLAG.CAPTION"
|
|
msgid "Drop readonly fla&g"
|
|
msgstr "Flag atributo somente leit&ura"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
|
|
msgid "E&xclude empty directories"
|
|
msgstr "E&xcluir pastas vazias"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
|
|
msgid "Fo&llow links"
|
|
msgstr "S&eguir links"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
|
|
msgid "&Reserve space"
|
|
msgstr "&Reservar espaço"
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
|
|
msgid "&Verify"
|
|
msgstr ""
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
|
|
msgid "What to do when cannot set file time, attributes, etc."
|
|
msgstr "O que fazer quando não conseguir definir hora, atributos, etc. do arquivo."
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
|
|
msgid "Use file template"
|
|
msgstr "Usar modelo de arquivo."
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
|
|
msgid "When dir&ectory exists"
|
|
msgstr "Quando a pa&sta existe."
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
|
|
msgctxt "TFILESYSTEMCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
|
msgid "When &file exists"
|
|
msgstr "Quando o &arquivo existe."
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
|
|
msgid "When ca&nnot set property"
|
|
msgstr "Quando não conseguir definir propriedade."
|
|
|
|
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
|
|
msgid "<no template>"
|
|
msgstr "<sem modelos>"
|
|
|
|
#: tfrmabout.btnclose.caption
|
|
msgctxt "TFRMABOUT.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Fechar"
|
|
|
|
#: tfrmabout.btncopytoclipboard.caption
|
|
msgid "Copy to clipboard"
|
|
msgstr "Copiar para a área de transferência."
|
|
|
|
#: tfrmabout.caption
|
|
msgctxt "TFRMABOUT.CAPTION"
|
|
msgid "About"
|
|
msgstr "Sobre"
|
|
|
|
#: tfrmabout.lblbuild.caption
|
|
msgctxt "tfrmabout.lblbuild.caption"
|
|
msgid "Build"
|
|
msgstr "Construir"
|
|
|
|
#: tfrmabout.lblfreepascalver.caption
|
|
msgctxt "tfrmabout.lblfreepascalver.caption"
|
|
msgid "Free Pascal"
|
|
msgstr "Free Pascal"
|
|
|
|
#: tfrmabout.lblhomepage.caption
|
|
msgid "Home Page:"
|
|
msgstr "Página Web:"
|
|
|
|
#: tfrmabout.lblhomepageaddress.caption
|
|
msgid "http://doublecmd.sourceforge.net"
|
|
msgstr "http://doublecmd.sourceforge.net"
|
|
|
|
#: tfrmabout.lbllazarusver.caption
|
|
msgctxt "tfrmabout.lbllazarusver.caption"
|
|
msgid "Lazarus"
|
|
msgstr "Lazarus"
|
|
|
|
#: tfrmabout.lblrevision.caption
|
|
msgctxt "TFRMABOUT.LBLREVISION.CAPTION"
|
|
msgid "Revision"
|
|
msgstr "Revisão"
|
|
|
|
#: tfrmabout.lbltitle.caption
|
|
msgctxt "TFRMABOUT.LBLTITLE.CAPTION"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmabout.lblversion.caption
|
|
msgctxt "tfrmabout.lblversion.caption"
|
|
msgid "Version"
|
|
msgstr "Versão"
|
|
|
|
#: tfrmattributesedit.btncancel.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmattributesedit.btnok.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmattributesedit.btnreset.caption
|
|
msgid "&Reset"
|
|
msgstr "&Reiniciar"
|
|
|
|
#: tfrmattributesedit.caption
|
|
msgid "Choose attributes"
|
|
msgstr "Escolher atributos"
|
|
|
|
#: tfrmattributesedit.cbarchive.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBARCHIVE.CAPTION"
|
|
msgid "&Archive"
|
|
msgstr "&Arquivo"
|
|
|
|
#: tfrmattributesedit.cbcompressed.caption
|
|
msgid "Co&mpressed"
|
|
msgstr "Co&mprimido"
|
|
|
|
#: tfrmattributesedit.cbdirectory.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBDIRECTORY.CAPTION"
|
|
msgid "&Directory"
|
|
msgstr "&Pasta"
|
|
|
|
#: tfrmattributesedit.cbencrypted.caption
|
|
msgid "&Encrypted"
|
|
msgstr "&Criptografado"
|
|
|
|
#: tfrmattributesedit.cbhidden.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBHIDDEN.CAPTION"
|
|
msgid "&Hidden"
|
|
msgstr "&Oculto"
|
|
|
|
#: tfrmattributesedit.cbreadonly.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBREADONLY.CAPTION"
|
|
msgid "Read o&nly"
|
|
msgstr "Somente &leitura"
|
|
|
|
#: tfrmattributesedit.cbsgid.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBSGID.CAPTION"
|
|
msgid "SGID"
|
|
msgstr "SGID"
|
|
|
|
#: tfrmattributesedit.cbsparse.caption
|
|
msgid "S&parse"
|
|
msgstr "Es&parso"
|
|
|
|
#: tfrmattributesedit.cbsticky.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBSTICKY.CAPTION"
|
|
msgid "Sticky"
|
|
msgstr "Espesso"
|
|
|
|
#: tfrmattributesedit.cbsuid.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBSUID.CAPTION"
|
|
msgid "SUID"
|
|
msgstr "SUID"
|
|
|
|
#: tfrmattributesedit.cbsymlink.caption
|
|
msgid "&Symlink"
|
|
msgstr "Link &simbólica"
|
|
|
|
#: tfrmattributesedit.cbsystem.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.CBSYSTEM.CAPTION"
|
|
msgid "S&ystem"
|
|
msgstr "S&istema"
|
|
|
|
#: tfrmattributesedit.cbtemporary.caption
|
|
msgid "&Temporary"
|
|
msgstr "&Temporário"
|
|
|
|
#: tfrmattributesedit.gbntfsattributes.caption
|
|
msgid "NTFS attributes"
|
|
msgstr "Atributos NTFS"
|
|
|
|
#: tfrmattributesedit.gbwingeneral.caption
|
|
msgid "General attributes"
|
|
msgstr "Atributos gerais"
|
|
|
|
#: tfrmattributesedit.lblattrbitsstr.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRBITSSTR.CAPTION"
|
|
msgid "Bits:"
|
|
msgstr "Bits:"
|
|
|
|
#: tfrmattributesedit.lblattrgroupstr.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLATTRGROUPSTR.CAPTION"
|
|
msgid "Group"
|
|
msgstr "Grupo"
|
|
|
|
#: tfrmattributesedit.lblattrotherstr.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROTHERSTR.CAPTION"
|
|
msgid "Other"
|
|
msgstr "Outro"
|
|
|
|
#: tfrmattributesedit.lblattrownerstr.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLATTROWNERSTR.CAPTION"
|
|
msgid "Owner"
|
|
msgstr "Proprietário"
|
|
|
|
#: tfrmattributesedit.lblexec.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLEXEC.CAPTION"
|
|
msgid "Execute"
|
|
msgstr "Executar"
|
|
|
|
#: tfrmattributesedit.lblread.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLREAD.CAPTION"
|
|
msgid "Read"
|
|
msgstr "Ler"
|
|
|
|
#: tfrmattributesedit.lbltextattrs.caption
|
|
msgid "As te&xt:"
|
|
msgstr "Como te&xto:"
|
|
|
|
#: tfrmattributesedit.lblwrite.caption
|
|
msgctxt "TFRMATTRIBUTESEDIT.LBLWRITE.CAPTION"
|
|
msgid "Write"
|
|
msgstr "Escrever"
|
|
|
|
#: tfrmbenchmark.caption
|
|
msgid "Benchmark"
|
|
msgstr ""
|
|
|
|
#: tfrmbenchmark.lblbenchmarksize.caption
|
|
msgid "Benchmark data size: %d MB"
|
|
msgstr ""
|
|
|
|
#: tfrmbenchmark.stgresult.columns[0].title.caption
|
|
msgid "Hash"
|
|
msgstr ""
|
|
|
|
#: tfrmbenchmark.stgresult.columns[1].title.caption
|
|
msgid "Time (ms)"
|
|
msgstr ""
|
|
|
|
#: tfrmbenchmark.stgresult.columns[2].title.caption
|
|
msgid "Speed (MB/s)"
|
|
msgstr ""
|
|
|
|
#: tfrmchecksumcalc.caption
|
|
msgctxt "TFRMCHECKSUMCALC.CAPTION"
|
|
msgid "Calculate checksum..."
|
|
msgstr "Calcular checksum..."
|
|
|
|
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
|
|
msgid "Open checksum file after job is completed"
|
|
msgstr "Abrir arq checksum após trabalho concluído."
|
|
|
|
#: tfrmchecksumcalc.cbseparatefile.caption
|
|
msgid "C&reate separate checksum file for each file"
|
|
msgstr "C&riar arquivo checksum separado para cada arquivo."
|
|
|
|
#: tfrmchecksumcalc.lblsaveto.caption
|
|
msgid "&Save checksum file(s) to:"
|
|
msgstr "Gra&var arquivos checksum em:"
|
|
|
|
#: tfrmchecksumverify.btnclose.caption
|
|
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Fechar"
|
|
|
|
#: tfrmchecksumverify.caption
|
|
msgctxt "TFRMCHECKSUMVERIFY.CAPTION"
|
|
msgid "Verify checksum..."
|
|
msgstr "Verificar checksum..."
|
|
|
|
#: tfrmconnectionmanager.btnadd.caption
|
|
msgctxt "TFRMCONNECTIONMANAGER.BTNADD.CAPTION"
|
|
msgid "A&dd"
|
|
msgstr "A&dicionar"
|
|
|
|
#: tfrmconnectionmanager.btncancel.caption
|
|
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmconnectionmanager.btnconnect.caption
|
|
msgid "C&onnect"
|
|
msgstr "C&onectar"
|
|
|
|
#: tfrmconnectionmanager.btndelete.caption
|
|
msgctxt "TFRMCONNECTIONMANAGER.BTNDELETE.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "&Excluir"
|
|
|
|
#: tfrmconnectionmanager.btnedit.caption
|
|
msgctxt "TFRMCONNECTIONMANAGER.BTNEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "&Editar"
|
|
|
|
#: tfrmconnectionmanager.caption
|
|
msgid "Connection manager"
|
|
msgstr "Gerenciador de conexão"
|
|
|
|
#: tfrmconnectionmanager.gbconnectto.caption
|
|
msgid "Connect to:"
|
|
msgstr "Conectar a:"
|
|
|
|
#: tfrmcopydlg.btnaddtoqueue.caption
|
|
msgid "A&dd To Queue"
|
|
msgstr "A&dicionar à fila"
|
|
|
|
#: tfrmcopydlg.btncancel.caption
|
|
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmcopydlg.btnoptions.caption
|
|
msgid "O&ptions"
|
|
msgstr "O&pções"
|
|
|
|
#: tfrmcopydlg.btnsaveoptions.caption
|
|
msgid "Sa&ve these options as default"
|
|
msgstr "Sal&var estas opções como default."
|
|
|
|
#: tfrmcopydlg.caption
|
|
msgctxt "TFRMCOPYDLG.CAPTION"
|
|
msgid "Copy file(s)"
|
|
msgstr "Copiar arquivo(s)"
|
|
|
|
#: tfrmcopydlg.mnunewqueue.caption
|
|
msgctxt "tfrmcopydlg.mnunewqueue.caption"
|
|
msgid "New queue"
|
|
msgstr "Nova fila"
|
|
|
|
#: tfrmcopydlg.mnuqueue1.caption
|
|
msgctxt "tfrmcopydlg.mnuqueue1.caption"
|
|
msgid "Queue 1"
|
|
msgstr "Fila 1"
|
|
|
|
#: tfrmcopydlg.mnuqueue2.caption
|
|
msgctxt "tfrmcopydlg.mnuqueue2.caption"
|
|
msgid "Queue 2"
|
|
msgstr "Fila 2"
|
|
|
|
#: tfrmcopydlg.mnuqueue3.caption
|
|
msgctxt "tfrmcopydlg.mnuqueue3.caption"
|
|
msgid "Queue 3"
|
|
msgstr "Fila 3"
|
|
|
|
#: tfrmcopydlg.mnuqueue4.caption
|
|
msgctxt "tfrmcopydlg.mnuqueue4.caption"
|
|
msgid "Queue 4"
|
|
msgstr "Fila 4"
|
|
|
|
#: tfrmcopydlg.mnuqueue5.caption
|
|
msgctxt "tfrmcopydlg.mnuqueue5.caption"
|
|
msgid "Queue 5"
|
|
msgstr "Fila 5"
|
|
|
|
#: tfrmdescredit.actsavedescription.caption
|
|
msgid "Save Description"
|
|
msgstr "Salvar descrição"
|
|
|
|
#: tfrmdescredit.btncancel.caption
|
|
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmdescredit.btnok.caption
|
|
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmdescredit.caption
|
|
msgid "File/folder comment"
|
|
msgstr "Comentário do arquivo/pasta."
|
|
|
|
#: tfrmdescredit.lbleditcommentfor.caption
|
|
msgid "E&dit comment for:"
|
|
msgstr "E&ditar comentário de:"
|
|
|
|
#: tfrmdescredit.lblencoding.caption
|
|
msgctxt "TFRMDESCREDIT.LBLENCODING.CAPTION"
|
|
msgid "&Encoding:"
|
|
msgstr "Codificando:"
|
|
|
|
#: tfrmdescredit.lblfilename.caption
|
|
msgctxt "TFRMDESCREDIT.LBLFILENAME.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmdiffer.actabout.caption
|
|
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
|
|
msgid "About"
|
|
msgstr "Sobre"
|
|
|
|
#: tfrmdiffer.actautocompare.caption
|
|
msgid "Auto Compare"
|
|
msgstr "Comparar automaticamente."
|
|
|
|
#: tfrmdiffer.actbinarycompare.caption
|
|
msgid "Binary Mode"
|
|
msgstr "Modo binário"
|
|
|
|
#: tfrmdiffer.actcancelcompare.caption
|
|
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.CAPTION"
|
|
msgid "Cancel"
|
|
msgstr "Cancelar"
|
|
|
|
#: tfrmdiffer.actcancelcompare.hint
|
|
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
|
|
msgid "Cancel"
|
|
msgstr "Cancelar"
|
|
|
|
#: tfrmdiffer.actcopylefttoright.caption
|
|
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.CAPTION"
|
|
msgid "Copy Block Right"
|
|
msgstr "Copiar bloco à direita"
|
|
|
|
#: tfrmdiffer.actcopylefttoright.hint
|
|
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
|
|
msgid "Copy Block Right"
|
|
msgstr "Copiar bloco à direita"
|
|
|
|
#: tfrmdiffer.actcopyrighttoleft.caption
|
|
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.CAPTION"
|
|
msgid "Copy Block Left"
|
|
msgstr "Copiar bloco à esquerda"
|
|
|
|
#: tfrmdiffer.actcopyrighttoleft.hint
|
|
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
|
|
msgid "Copy Block Left"
|
|
msgstr "Copiar bloco à esquerda"
|
|
|
|
#: tfrmdiffer.acteditcopy.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITCOPY.CAPTION"
|
|
msgid "Copy"
|
|
msgstr "Copiar"
|
|
|
|
#: tfrmdiffer.acteditcut.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITCUT.CAPTION"
|
|
msgid "Cut"
|
|
msgstr "Cortar"
|
|
|
|
#: tfrmdiffer.acteditdelete.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITDELETE.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "Excluir"
|
|
|
|
#: tfrmdiffer.acteditpaste.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITPASTE.CAPTION"
|
|
msgid "Paste"
|
|
msgstr "Colar"
|
|
|
|
#: tfrmdiffer.acteditredo.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITREDO.CAPTION"
|
|
msgid "Redo"
|
|
msgstr "Refazer"
|
|
|
|
#: tfrmdiffer.acteditselectall.caption
|
|
msgid "Select &All"
|
|
msgstr "Selecion&ar Todos"
|
|
|
|
#: tfrmdiffer.acteditundo.caption
|
|
msgctxt "TFRMDIFFER.ACTEDITUNDO.CAPTION"
|
|
msgid "Undo"
|
|
msgstr "Desfazer"
|
|
|
|
#: tfrmdiffer.actexit.caption
|
|
msgctxt "TFRMDIFFER.ACTEXIT.CAPTION"
|
|
msgid "E&xit"
|
|
msgstr "&Sair"
|
|
|
|
#: tfrmdiffer.actfirstdifference.caption
|
|
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.CAPTION"
|
|
msgid "First Difference"
|
|
msgstr "Primeira diferença"
|
|
|
|
#: tfrmdiffer.actfirstdifference.hint
|
|
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
|
|
msgid "First Difference"
|
|
msgstr "Primeira diferença"
|
|
|
|
#: tfrmdiffer.actignorecase.caption
|
|
msgid "Ignore Case"
|
|
msgstr "Ignorar maiúsculas"
|
|
|
|
#: tfrmdiffer.actignorewhitespace.caption
|
|
msgid "Ignore Blanks"
|
|
msgstr "Ignorar espaços"
|
|
|
|
#: tfrmdiffer.actkeepscrolling.caption
|
|
msgid "Keep Scrolling"
|
|
msgstr "Continuar deslocamento"
|
|
|
|
#: tfrmdiffer.actlastdifference.caption
|
|
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.CAPTION"
|
|
msgid "Last Difference"
|
|
msgstr "Última diferença"
|
|
|
|
#: tfrmdiffer.actlastdifference.hint
|
|
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
|
|
msgid "Last Difference"
|
|
msgstr "Última diferença"
|
|
|
|
#: tfrmdiffer.actlinedifferences.caption
|
|
msgid "Line Differences"
|
|
msgstr "Diferenças de linha"
|
|
|
|
#: tfrmdiffer.actnextdifference.caption
|
|
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.CAPTION"
|
|
msgid "Next Difference"
|
|
msgstr "Diferença seguinte"
|
|
|
|
#: tfrmdiffer.actnextdifference.hint
|
|
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
|
|
msgid "Next Difference"
|
|
msgstr "Diferença seguinte"
|
|
|
|
#: tfrmdiffer.actopenleft.caption
|
|
msgid "Open Left..."
|
|
msgstr "Abrir esquerdo..."
|
|
|
|
#: tfrmdiffer.actopenright.caption
|
|
msgid "Open Right..."
|
|
msgstr "Abrir direito..."
|
|
|
|
#: tfrmdiffer.actpaintbackground.caption
|
|
msgid "Paint Background"
|
|
msgstr "Pintar fundo"
|
|
|
|
#: tfrmdiffer.actprevdifference.caption
|
|
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.CAPTION"
|
|
msgid "Previous Difference"
|
|
msgstr "Diferença anterior"
|
|
|
|
#: tfrmdiffer.actprevdifference.hint
|
|
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
|
|
msgid "Previous Difference"
|
|
msgstr "Diferença anterior"
|
|
|
|
#: tfrmdiffer.actreload.caption
|
|
msgctxt "TFRMDIFFER.ACTRELOAD.CAPTION"
|
|
msgid "&Reload"
|
|
msgstr "&Recarregar"
|
|
|
|
#: tfrmdiffer.actreload.hint
|
|
msgctxt "TFRMDIFFER.ACTRELOAD.HINT"
|
|
msgid "Reload"
|
|
msgstr "Recarregar"
|
|
|
|
#: tfrmdiffer.actsave.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVE.CAPTION"
|
|
msgid "Save"
|
|
msgstr "Salvar"
|
|
|
|
#: tfrmdiffer.actsave.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
|
|
msgid "Save"
|
|
msgstr "Salvar"
|
|
|
|
#: tfrmdiffer.actsaveas.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVEAS.CAPTION"
|
|
msgid "Save as..."
|
|
msgstr "Salvar como..."
|
|
|
|
#: tfrmdiffer.actsaveas.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
|
|
msgid "Save as..."
|
|
msgstr "Salvar como..."
|
|
|
|
#: tfrmdiffer.actsaveleft.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVELEFT.CAPTION"
|
|
msgid "Save Left"
|
|
msgstr "Salvar esquerdo"
|
|
|
|
#: tfrmdiffer.actsaveleft.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
|
|
msgid "Save Left"
|
|
msgstr "Salvar esquerdo"
|
|
|
|
#: tfrmdiffer.actsaveleftas.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.CAPTION"
|
|
msgid "Save Left As..."
|
|
msgstr "Salvar esquerdo como..."
|
|
|
|
#: tfrmdiffer.actsaveleftas.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
|
|
msgid "Save Left As..."
|
|
msgstr "Salvar esquerdo como..."
|
|
|
|
#: tfrmdiffer.actsaveright.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVERIGHT.CAPTION"
|
|
msgid "Save Right"
|
|
msgstr "Salvar direito"
|
|
|
|
#: tfrmdiffer.actsaveright.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
|
|
msgid "Save Right"
|
|
msgstr "Salvar direito"
|
|
|
|
#: tfrmdiffer.actsaverightas.caption
|
|
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.CAPTION"
|
|
msgid "Save Right As..."
|
|
msgstr "Salvar direito como..."
|
|
|
|
#: tfrmdiffer.actsaverightas.hint
|
|
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
|
|
msgid "Save Right As..."
|
|
msgstr "Salvar direito como...."
|
|
|
|
#: tfrmdiffer.actstartcompare.caption
|
|
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.CAPTION"
|
|
msgid "Compare"
|
|
msgstr "Comparar"
|
|
|
|
#: tfrmdiffer.actstartcompare.hint
|
|
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
|
|
msgid "Compare"
|
|
msgstr "Comparar"
|
|
|
|
#: tfrmdiffer.btnleftencoding.hint
|
|
msgctxt "TFRMDIFFER.BTNLEFTENCODING.HINT"
|
|
msgid "Encoding"
|
|
msgstr "Codificar"
|
|
|
|
#: tfrmdiffer.btnrightencoding.hint
|
|
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
|
|
msgid "Encoding"
|
|
msgstr "Codificar"
|
|
|
|
#: tfrmdiffer.caption
|
|
msgctxt "TFRMDIFFER.CAPTION"
|
|
msgid "Compare files"
|
|
msgstr "Comparar arquivos"
|
|
|
|
#: tfrmdiffer.midivider1.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider10.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider2.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider3.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider4.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider5.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider6.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider7.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER7.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider8.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.midivider9.caption
|
|
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.miencodingleft.caption
|
|
msgid "&Left"
|
|
msgstr "&Esquerdo"
|
|
|
|
#: tfrmdiffer.miencodingright.caption
|
|
msgid "&Right"
|
|
msgstr "&Direito"
|
|
|
|
#: tfrmdiffer.miseparator1.caption
|
|
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.miseparator2.caption
|
|
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmdiffer.mnuactions.caption
|
|
msgid "&Actions"
|
|
msgstr "&Ações"
|
|
|
|
#: tfrmdiffer.mnuedit.caption
|
|
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "&Editar"
|
|
|
|
#: tfrmdiffer.mnuencoding.caption
|
|
msgctxt "TFRMDIFFER.MNUENCODING.CAPTION"
|
|
msgid "En&coding"
|
|
msgstr "&Codificar"
|
|
|
|
#: tfrmdiffer.mnufile.caption
|
|
msgctxt "TFRMDIFFER.MNUFILE.CAPTION"
|
|
msgid "&File"
|
|
msgstr "&Arquivo"
|
|
|
|
#: tfrmdiffer.mnuoptions.caption
|
|
msgctxt "TFRMDIFFER.MNUOPTIONS.CAPTION"
|
|
msgid "&Options"
|
|
msgstr "&Opções"
|
|
|
|
#: tfrmedithotkey.btnaddshortcut.hint
|
|
msgid "Add new shortcut to sequence"
|
|
msgstr "Adicionar novo atalho à sequência."
|
|
|
|
#: tfrmedithotkey.btncancel.caption
|
|
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmedithotkey.btnok.caption
|
|
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmedithotkey.btnremoveshortcut.hint
|
|
msgid "Remove last shortcut from sequence"
|
|
msgstr "Remover último atalho da sequência."
|
|
|
|
#: tfrmedithotkey.btnselectfromlist.hint
|
|
msgid "Select shortcut from list of remaining free available keys"
|
|
msgstr ""
|
|
|
|
#: tfrmedithotkey.cghkcontrols.caption
|
|
msgctxt "TFRMEDITHOTKEY.CGHKCONTROLS.CAPTION"
|
|
msgid "Only for these controls"
|
|
msgstr "Só para estes controles."
|
|
|
|
#: tfrmedithotkey.lblparameters.caption
|
|
msgid "&Parameters (each in a separate line):"
|
|
msgstr "&Parâmetros (cada um numa linha separada)."
|
|
|
|
#: tfrmedithotkey.lblshortcuts.caption
|
|
msgid "Shortcuts:"
|
|
msgstr "Atalhos:"
|
|
|
|
#: tfrmeditor.actabout.caption
|
|
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
|
|
msgid "About"
|
|
msgstr "Sobre"
|
|
|
|
#: tfrmeditor.actabout.hint
|
|
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
|
|
msgid "About"
|
|
msgstr "Sobre"
|
|
|
|
#: tfrmeditor.actconfhigh.caption
|
|
msgid "&Configuration"
|
|
msgstr "&Configuração"
|
|
|
|
#: tfrmeditor.actconfhigh.hint
|
|
msgctxt "TFRMEDITOR.ACTCONFHIGH.HINT"
|
|
msgid "Configuration"
|
|
msgstr "Configuração"
|
|
|
|
#: tfrmeditor.acteditcopy.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
|
|
msgid "Copy"
|
|
msgstr "Copiar"
|
|
|
|
#: tfrmeditor.acteditcopy.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
|
|
msgid "Copy"
|
|
msgstr "Copiar"
|
|
|
|
#: tfrmeditor.acteditcut.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
|
|
msgid "Cut"
|
|
msgstr "Cortar"
|
|
|
|
#: tfrmeditor.acteditcut.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
|
|
msgid "Cut"
|
|
msgstr "Cortar"
|
|
|
|
#: tfrmeditor.acteditdelete.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "Excluir"
|
|
|
|
#: tfrmeditor.acteditdelete.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
|
|
msgid "Delete"
|
|
msgstr "Excluir"
|
|
|
|
#: tfrmeditor.acteditfind.caption
|
|
#, fuzzy
|
|
#| msgid "&Find "
|
|
msgctxt "tfrmeditor.acteditfind.caption"
|
|
msgid "&Find"
|
|
msgstr "&Localizar"
|
|
|
|
#: tfrmeditor.acteditfind.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITFIND.HINT"
|
|
msgid "Find"
|
|
msgstr "Localizar"
|
|
|
|
#: tfrmeditor.acteditfindnext.caption
|
|
msgctxt "tfrmeditor.acteditfindnext.caption"
|
|
msgid "Find next"
|
|
msgstr "Localizar próxim"
|
|
|
|
#: tfrmeditor.acteditfindnext.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
|
|
msgid "Find next"
|
|
msgstr "Localizar próxim"
|
|
|
|
#: tfrmeditor.acteditfindprevious.caption
|
|
msgctxt "tfrmeditor.acteditfindprevious.caption"
|
|
msgid "Find previous"
|
|
msgstr ""
|
|
|
|
#: tfrmeditor.acteditgotoline.caption
|
|
msgctxt "tfrmeditor.acteditgotoline.caption"
|
|
msgid "Goto Line..."
|
|
msgstr "Ir para linha..."
|
|
|
|
#: tfrmeditor.acteditlineendcr.caption
|
|
msgctxt "tfrmeditor.acteditlineendcr.caption"
|
|
msgid "Mac (CR)"
|
|
msgstr "Mac (CR)"
|
|
|
|
#: tfrmeditor.acteditlineendcr.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
|
|
msgid "Mac (CR)"
|
|
msgstr "Mac (CR)"
|
|
|
|
#: tfrmeditor.acteditlineendcrlf.caption
|
|
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
|
|
msgid "Windows (CRLF)"
|
|
msgstr "Windows (CRLF)"
|
|
|
|
#: tfrmeditor.acteditlineendcrlf.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
|
|
msgid "Windows (CRLF)"
|
|
msgstr "Windows (CRLF)"
|
|
|
|
#: tfrmeditor.acteditlineendlf.caption
|
|
msgctxt "tfrmeditor.acteditlineendlf.caption"
|
|
msgid "Unix (LF)"
|
|
msgstr "Unix (LF)"
|
|
|
|
#: tfrmeditor.acteditlineendlf.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
|
|
msgid "Unix (LF)"
|
|
msgstr "Unix (LF)"
|
|
|
|
#: tfrmeditor.acteditpaste.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
|
|
msgid "Paste"
|
|
msgstr "Colar"
|
|
|
|
#: tfrmeditor.acteditpaste.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
|
|
msgid "Paste"
|
|
msgstr "Colar"
|
|
|
|
#: tfrmeditor.acteditredo.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
|
|
msgid "Redo"
|
|
msgstr "Refazer"
|
|
|
|
#: tfrmeditor.acteditredo.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
|
|
msgid "Redo"
|
|
msgstr "Refazer"
|
|
|
|
#: tfrmeditor.acteditrplc.caption
|
|
msgid "&Replace"
|
|
msgstr "Substitui&r"
|
|
|
|
#: tfrmeditor.acteditrplc.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITRPLC.HINT"
|
|
msgid "Replace"
|
|
msgstr "Substituir"
|
|
|
|
#: tfrmeditor.acteditselectall.caption
|
|
msgid "Select&All"
|
|
msgstr "Selecion&ar todos"
|
|
|
|
#: tfrmeditor.acteditselectall.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITSELECTALL.HINT"
|
|
msgid "Select All"
|
|
msgstr "Selecionar todos"
|
|
|
|
#: tfrmeditor.acteditundo.caption
|
|
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
|
|
msgid "Undo"
|
|
msgstr "Desfazer"
|
|
|
|
#: tfrmeditor.acteditundo.hint
|
|
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
|
|
msgid "Undo"
|
|
msgstr "Desfazer"
|
|
|
|
#: tfrmeditor.actfileclose.caption
|
|
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Fechar"
|
|
|
|
#: tfrmeditor.actfileclose.hint
|
|
msgctxt "TFRMEDITOR.ACTFILECLOSE.HINT"
|
|
msgid "Close"
|
|
msgstr "Fechar"
|
|
|
|
#: tfrmeditor.actfileexit.caption
|
|
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
|
|
msgid "E&xit"
|
|
msgstr "&Sair"
|
|
|
|
#: tfrmeditor.actfileexit.hint
|
|
msgctxt "tfrmeditor.actfileexit.hint"
|
|
msgid "Exit"
|
|
msgstr "Sair"
|
|
|
|
#: tfrmeditor.actfilenew.caption
|
|
msgctxt "TFRMEDITOR.ACTFILENEW.CAPTION"
|
|
msgid "&New"
|
|
msgstr "&Novo"
|
|
|
|
#: tfrmeditor.actfilenew.hint
|
|
msgctxt "TFRMEDITOR.ACTFILENEW.HINT"
|
|
msgid "New"
|
|
msgstr "Novo"
|
|
|
|
#: tfrmeditor.actfileopen.caption
|
|
msgid "&Open"
|
|
msgstr "&Abrir"
|
|
|
|
#: tfrmeditor.actfileopen.hint
|
|
msgctxt "TFRMEDITOR.ACTFILEOPEN.HINT"
|
|
msgid "Open"
|
|
msgstr "Abrir"
|
|
|
|
#: tfrmeditor.actfilereload.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmeditor.actfilereload.caption"
|
|
msgid "Reload"
|
|
msgstr "Recarregar"
|
|
|
|
#: tfrmeditor.actfilesave.caption
|
|
msgctxt "TFRMEDITOR.ACTFILESAVE.CAPTION"
|
|
msgid "&Save"
|
|
msgstr "&Salvar"
|
|
|
|
#: tfrmeditor.actfilesave.hint
|
|
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
|
|
msgid "Save"
|
|
msgstr "Salvar"
|
|
|
|
#: tfrmeditor.actfilesaveas.caption
|
|
#, fuzzy
|
|
#| msgid "Save &As.."
|
|
msgid "Save &As..."
|
|
msgstr "Sal&var como..."
|
|
|
|
#: tfrmeditor.actfilesaveas.hint
|
|
msgid "Save As"
|
|
msgstr "Salvar como"
|
|
|
|
#: tfrmeditor.actsaveall.caption
|
|
msgid "Sa&ve All"
|
|
msgstr "Salvar &tudo"
|
|
|
|
#: tfrmeditor.actsaveall.hint
|
|
msgid "Save All"
|
|
msgstr "Salvar tudo"
|
|
|
|
#: tfrmeditor.caption
|
|
msgctxt "TFRMEDITOR.CAPTION"
|
|
msgid "Editor"
|
|
msgstr "Editor"
|
|
|
|
#: tfrmeditor.help1.caption
|
|
msgctxt "TFRMEDITOR.HELP1.CAPTION"
|
|
msgid "&Help"
|
|
msgstr "A&juda"
|
|
|
|
#: tfrmeditor.miedit.caption
|
|
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "&Editar"
|
|
|
|
#: tfrmeditor.miencoding.caption
|
|
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
|
|
msgid "En&coding"
|
|
msgstr "&Codificar"
|
|
|
|
#: tfrmeditor.miencodingin.caption
|
|
msgid "Open as"
|
|
msgstr "Abrir como"
|
|
|
|
#: tfrmeditor.miencodingout.caption
|
|
msgctxt "tfrmeditor.miencodingout.caption"
|
|
msgid "Save as"
|
|
msgstr "Salvar como"
|
|
|
|
#: tfrmeditor.mifile.caption
|
|
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
|
|
msgid "&File"
|
|
msgstr "&Arquivo"
|
|
|
|
#: tfrmeditor.mihighlight.caption
|
|
msgid "Syntax highlight"
|
|
msgstr "Realçar sintaxe"
|
|
|
|
#: tfrmeditor.milineendtype.caption
|
|
msgid "End Of Line"
|
|
msgstr "Fim de linha"
|
|
|
|
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmeditsearchreplace.buttonpanel.cancelbutton.caption"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmeditsearchreplace.buttonpanel.okbutton.caption"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHCASESENSITIVE.CAPTION"
|
|
msgid "C&ase sensitivity"
|
|
msgstr "Sensível a maiúsculas"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHFROMCURSOR.CAPTION"
|
|
msgid "S&earch from caret"
|
|
msgstr "&Localizar a partir do cursor"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchregexp.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHREGEXP.CAPTION"
|
|
msgid "&Regular expressions"
|
|
msgstr "Expressões ®ulares"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHSELECTEDONLY.CAPTION"
|
|
msgid "Selected &text only"
|
|
msgstr "Só &texto selecionado"
|
|
|
|
#: tfrmeditsearchreplace.cbsearchwholewords.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.CBSEARCHWHOLEWORDS.CAPTION"
|
|
msgid "&Whole words only"
|
|
msgstr "Só &palavras completas"
|
|
|
|
#: tfrmeditsearchreplace.gbsearchoptions.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.GBSEARCHOPTIONS.CAPTION"
|
|
msgid "Option"
|
|
msgstr "Opção"
|
|
|
|
#: tfrmeditsearchreplace.lblreplacewith.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.LBLREPLACEWITH.CAPTION"
|
|
msgid "&Replace with:"
|
|
msgstr "Substitui&r com"
|
|
|
|
#: tfrmeditsearchreplace.lblsearchfor.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.LBLSEARCHFOR.CAPTION"
|
|
msgid "&Search for:"
|
|
msgstr "Proc&urar por:"
|
|
|
|
#: tfrmeditsearchreplace.rgsearchdirection.caption
|
|
msgctxt "TFRMEDITSEARCHREPLACE.RGSEARCHDIRECTION.CAPTION"
|
|
msgid "Direction"
|
|
msgstr "Direção"
|
|
|
|
#: tfrmextractdlg.caption
|
|
msgctxt "TFRMEXTRACTDLG.CAPTION"
|
|
msgid "Unpack files"
|
|
msgstr "Descomprimir arquivos"
|
|
|
|
#: tfrmextractdlg.cbextractpath.caption
|
|
msgid "&Unpack path names if stored with files"
|
|
msgstr "&Descomprimir nomes de caminho se armazenados com os arquivos."
|
|
|
|
#: tfrmextractdlg.cbfilemask.text
|
|
msgctxt "tfrmextractdlg.cbfilemask.text"
|
|
msgid "*.*"
|
|
msgstr "*.*"
|
|
|
|
#: tfrmextractdlg.cbinseparatefolder.caption
|
|
msgid "Unpack each archive to a &separate subdir (name of the archive)"
|
|
msgstr "Descomprimir cada arquivo para pastas &separadas (nome do arquivo)."
|
|
|
|
#: tfrmextractdlg.cboverwrite.caption
|
|
msgid "O&verwrite existing files"
|
|
msgstr "Subs&tituir arquivos existentes."
|
|
|
|
#: tfrmextractdlg.lblextractto.caption
|
|
msgid "To the &directory:"
|
|
msgstr "Para a &pasta:"
|
|
|
|
#: tfrmextractdlg.lblfilemask.caption
|
|
msgid "&Extract files matching file mask:"
|
|
msgstr "&Extrair arquivos com esta máscara:"
|
|
|
|
#: tfrmextractdlg.lblpassword.caption
|
|
msgid "&Password for encrypted files:"
|
|
msgstr "&Senha de arquivos criptografados:"
|
|
|
|
#: tfrmfileexecuteyourself.btnclose.caption
|
|
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Fechar"
|
|
|
|
#: tfrmfileexecuteyourself.caption
|
|
msgctxt "TFRMFILEEXECUTEYOURSELF.CAPTION"
|
|
msgid "Wait..."
|
|
msgstr "Aguarde..."
|
|
|
|
#: tfrmfileexecuteyourself.lblfilename.caption
|
|
msgid "File name:"
|
|
msgstr "Nome de arquivo:"
|
|
|
|
#: tfrmfileexecuteyourself.lblfrompath.caption
|
|
msgctxt "TFRMFILEEXECUTEYOURSELF.LBLFROMPATH.CAPTION"
|
|
msgid "From:"
|
|
msgstr "De:"
|
|
|
|
#: tfrmfileexecuteyourself.lblprompt.caption
|
|
msgid "Click on Close when the temporary file can be deleted!"
|
|
msgstr "Clique em Fechar quando o arquivo temporário puder ser apagado!"
|
|
|
|
#: tfrmfileop.btncancel.caption
|
|
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmfileop.btnminimizetopanel.caption
|
|
msgid "&To panel"
|
|
msgstr "&Para o painel"
|
|
|
|
#: tfrmfileop.btnviewoperations.caption
|
|
msgid "&View all"
|
|
msgstr "&Ver tudo"
|
|
|
|
#: tfrmfileop.lblcurrentoperation.caption
|
|
msgid "Current operation:"
|
|
msgstr "Operação atual:"
|
|
|
|
#: tfrmfileop.lblfrom.caption
|
|
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
|
|
msgid "From:"
|
|
msgstr "De:"
|
|
|
|
#: tfrmfileop.lblto.caption
|
|
msgid "To:"
|
|
msgstr "Para:"
|
|
|
|
#: tfrmfileproperties.btnclose.caption
|
|
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Fechar"
|
|
|
|
#: tfrmfileproperties.btnsetproperties.caption
|
|
msgid "&Set properties"
|
|
msgstr "&Definir propriedades"
|
|
|
|
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
|
|
msgid "Set to &all selected files"
|
|
msgstr "Definir p&ara todos os selecionados."
|
|
|
|
#: tfrmfileproperties.btnskipfile.caption
|
|
msgid "Ski&p this file"
|
|
msgstr "P&ular este arquivo."
|
|
|
|
#: tfrmfileproperties.caption
|
|
msgctxt "TFRMFILEPROPERTIES.CAPTION"
|
|
msgid "Properties"
|
|
msgstr "Propriedades"
|
|
|
|
#: tfrmfileproperties.cbsgid.caption
|
|
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
|
|
msgid "SGID"
|
|
msgstr "SGID"
|
|
|
|
#: tfrmfileproperties.cbsticky.caption
|
|
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
|
|
msgid "Sticky"
|
|
msgstr "Espesso"
|
|
|
|
#: tfrmfileproperties.cbsuid.caption
|
|
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
|
|
msgid "SUID"
|
|
msgstr "SUID"
|
|
|
|
#: tfrmfileproperties.chkexecutable.caption
|
|
msgid "Allow &executing file as program"
|
|
msgstr ""
|
|
|
|
#: tfrmfileproperties.gbowner.caption
|
|
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
|
|
msgid "Owner"
|
|
msgstr "Proprietário"
|
|
|
|
#: tfrmfileproperties.lblattrbitsstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
|
msgid "Bits:"
|
|
msgstr "Bits:"
|
|
|
|
#: tfrmfileproperties.lblattrgroupstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
|
msgid "Group"
|
|
msgstr "Grupo"
|
|
|
|
#: tfrmfileproperties.lblattrotherstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
|
msgid "Other"
|
|
msgstr "Outro"
|
|
|
|
#: tfrmfileproperties.lblattrownerstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
|
msgid "Owner"
|
|
msgstr "Proprietário"
|
|
|
|
#: tfrmfileproperties.lblattrtext.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
|
msgid "-----------"
|
|
msgstr "-----------"
|
|
|
|
#: tfrmfileproperties.lblattrtextstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
|
msgid "Text:"
|
|
msgstr "Texto:"
|
|
|
|
#: tfrmfileproperties.lblcontains.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblcontainsstr.caption
|
|
msgid "Contains:"
|
|
msgstr "Contém:"
|
|
|
|
#: tfrmfileproperties.lblexec.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
|
|
msgid "Execute"
|
|
msgstr "Executar"
|
|
|
|
#: tfrmfileproperties.lblexecutable.caption
|
|
msgid "Execute:"
|
|
msgstr ""
|
|
|
|
#: tfrmfileproperties.lblfile.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
|
|
msgid "File name"
|
|
msgstr "Nome de arquivo"
|
|
|
|
#: tfrmfileproperties.lblfilename.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblfilestr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLFILESTR.CAPTION"
|
|
msgid "File name"
|
|
msgstr "Nome de arquivo"
|
|
|
|
#: tfrmfileproperties.lblfolder.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblfolderstr.caption
|
|
msgctxt "tfrmfileproperties.lblfolderstr.caption"
|
|
msgid "Path:"
|
|
msgstr "Caminho:"
|
|
|
|
#: tfrmfileproperties.lblgroupstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLGROUPSTR.CAPTION"
|
|
msgid "&Group"
|
|
msgstr "&Grupo"
|
|
|
|
#: tfrmfileproperties.lbllastaccess.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lbllastaccessstr.caption
|
|
msgid "Last access:"
|
|
msgstr "Último acesso:"
|
|
|
|
#: tfrmfileproperties.lbllastmodif.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lbllastmodifstr.caption
|
|
msgid "Last modification:"
|
|
msgstr "Última modificação:"
|
|
|
|
#: tfrmfileproperties.lbllaststchange.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lbllaststchangestr.caption
|
|
msgid "Last status change:"
|
|
msgstr "Última alteração de estado:"
|
|
|
|
#: tfrmfileproperties.lbloctal.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLOCTAL.CAPTION"
|
|
msgid "Octal:"
|
|
msgstr "Octal:"
|
|
|
|
#: tfrmfileproperties.lblownerstr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLOWNERSTR.CAPTION"
|
|
msgid "O&wner"
|
|
msgstr "Propr&ietário"
|
|
|
|
#: tfrmfileproperties.lblread.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
|
|
msgid "Read"
|
|
msgstr "Ler"
|
|
|
|
#: tfrmfileproperties.lblsize.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblsizestr.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLSIZESTR.CAPTION"
|
|
msgid "Size:"
|
|
msgstr "Tamanho"
|
|
|
|
#: tfrmfileproperties.lblsymlink.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lblsymlinkstr.caption
|
|
msgid "Symlink to:"
|
|
msgstr "Link simbólica para:"
|
|
|
|
#: tfrmfileproperties.lbltype.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
|
|
msgid "???"
|
|
msgstr "???"
|
|
|
|
#: tfrmfileproperties.lbltypestr.caption
|
|
msgid "Type:"
|
|
msgstr "Tipo:"
|
|
|
|
#: tfrmfileproperties.lblwrite.caption
|
|
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
|
|
msgid "Write"
|
|
msgstr "Escrever"
|
|
|
|
#: tfrmfileproperties.sgimage.columns[0].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
|
|
msgid "Name"
|
|
msgstr "Nome"
|
|
|
|
#: tfrmfileproperties.sgimage.columns[1].title.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
|
|
msgid "Value"
|
|
msgstr "Valor"
|
|
|
|
#: tfrmfileproperties.tsattributes.caption
|
|
msgctxt "TFRMFILEPROPERTIES.TSATTRIBUTES.CAPTION"
|
|
msgid "Attributes"
|
|
msgstr "Atributos"
|
|
|
|
#: tfrmfileproperties.tsplugins.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfileproperties.tsplugins.caption"
|
|
msgid "Plugins"
|
|
msgstr "Suplementos"
|
|
|
|
#: tfrmfileproperties.tsproperties.caption
|
|
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
|
|
msgid "Properties"
|
|
msgstr "Propriedades"
|
|
|
|
#: tfrmfinddlg.actcancel.caption
|
|
#, fuzzy
|
|
#| msgid "actCancel"
|
|
msgid "C&ancel"
|
|
msgstr "actCancel"
|
|
|
|
#: tfrmfinddlg.actcancelclose.caption
|
|
msgid "Cancel search and close window"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actclose.caption
|
|
#, fuzzy
|
|
#| msgid "actClose"
|
|
msgctxt "tfrmfinddlg.actclose.caption"
|
|
msgid "&Close"
|
|
msgstr "actClose"
|
|
|
|
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
|
|
msgctxt "tfrmfinddlg.actconfigfilesearchhotkeys.caption"
|
|
msgid "Configuration of hot keys"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actedit.caption
|
|
#, fuzzy
|
|
#| msgid "actEdit"
|
|
msgctxt "tfrmfinddlg.actedit.caption"
|
|
msgid "&Edit"
|
|
msgstr "actEdit"
|
|
|
|
#: tfrmfinddlg.actfeedtolistbox.caption
|
|
#, fuzzy
|
|
#| msgid "actFeedToListbox"
|
|
msgid "Feed to &listbox"
|
|
msgstr "actFeedToListbox"
|
|
|
|
#: tfrmfinddlg.actfreefrommem.caption
|
|
msgid "Cancel search, close and free from memory"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actfreefrommemallothers.caption
|
|
msgid "For all other \"Find files\", cancel, close and free from memory"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actgotofile.caption
|
|
#, fuzzy
|
|
#| msgid "actGoToFile"
|
|
msgid "&Go to file"
|
|
msgstr "actGoToFile"
|
|
|
|
#: tfrmfinddlg.actintellifocus.caption
|
|
#, fuzzy
|
|
#| msgid "actIntelliFocus"
|
|
msgctxt "tfrmfinddlg.actintellifocus.caption"
|
|
msgid "Find Data"
|
|
msgstr "actIntelliFocus"
|
|
|
|
#: tfrmfinddlg.actlastsearch.caption
|
|
#, fuzzy
|
|
#| msgid "actLastSearch"
|
|
msgid "&Last search"
|
|
msgstr "actLastSearch"
|
|
|
|
#: tfrmfinddlg.actnewsearch.caption
|
|
#, fuzzy
|
|
#| msgid "actNewSearch"
|
|
msgid "&New search"
|
|
msgstr "actNewSearch"
|
|
|
|
#: tfrmfinddlg.actnewsearchclearfilters.caption
|
|
msgid "New search (clear filters)"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpageadvanced.caption
|
|
#, fuzzy
|
|
#| msgid "actPageAdvanced"
|
|
msgid "Go to page \"Advanced\""
|
|
msgstr "actPageAdvanced"
|
|
|
|
#: tfrmfinddlg.actpageloadsave.caption
|
|
#, fuzzy
|
|
#| msgid "actPageLoadSave"
|
|
msgid "Go to page \"Load/Save\""
|
|
msgstr "actPageLoadSave"
|
|
|
|
#: tfrmfinddlg.actpagenext.caption
|
|
msgid "Switch to Nex&t Page"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpageplugins.caption
|
|
#, fuzzy
|
|
#| msgid "actPagePlugins"
|
|
msgid "Go to page \"Plugins\""
|
|
msgstr "actPagePlugins"
|
|
|
|
#: tfrmfinddlg.actpageprev.caption
|
|
msgid "Switch to &Previous Page"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.actpageresults.caption
|
|
#, fuzzy
|
|
#| msgid "actPageResults"
|
|
msgid "Go to page \"Results\""
|
|
msgstr "actPageResults"
|
|
|
|
#: tfrmfinddlg.actpagestandard.caption
|
|
#, fuzzy
|
|
#| msgid "actPageStandard"
|
|
msgid "Go to page \"Standard\""
|
|
msgstr "actPageStandard"
|
|
|
|
#: tfrmfinddlg.actstart.caption
|
|
#, fuzzy
|
|
#| msgid "actStart"
|
|
msgctxt "tfrmfinddlg.actstart.caption"
|
|
msgid "&Start"
|
|
msgstr "actStart"
|
|
|
|
#: tfrmfinddlg.actview.caption
|
|
#, fuzzy
|
|
#| msgid "actView"
|
|
msgctxt "tfrmfinddlg.actview.caption"
|
|
msgid "&View"
|
|
msgstr "actView"
|
|
|
|
#: tfrmfinddlg.btnaddattribute.caption
|
|
msgctxt "tfrmfinddlg.btnaddattribute.caption"
|
|
msgid "&Add"
|
|
msgstr "&Adicionar"
|
|
|
|
#: tfrmfinddlg.btnattrshelp.caption
|
|
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
|
|
msgid "&Help"
|
|
msgstr "A&juda"
|
|
|
|
#: tfrmfinddlg.btnsavetemplate.caption
|
|
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
|
|
msgid "&Save"
|
|
msgstr "&Salvar"
|
|
|
|
#: tfrmfinddlg.btnsearchdelete.caption
|
|
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "&Excluir"
|
|
|
|
#: tfrmfinddlg.btnsearchload.caption
|
|
msgid "L&oad"
|
|
msgstr "&Carregar"
|
|
|
|
#: tfrmfinddlg.btnsearchsave.caption
|
|
msgid "S&ave"
|
|
msgstr "Sal&var"
|
|
|
|
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
|
|
msgid "Sa&ve with \"Start in directory\""
|
|
msgstr "S&alvar com \"Iniciar na pasta\""
|
|
|
|
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
|
|
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
|
|
msgstr "Se salvado, então \"Iniciar na pasta\" será restaurado ao carregar o modelo. Use se quer fixar a procura numa determinada pasta."
|
|
|
|
#: tfrmfinddlg.btnusetemplate.caption
|
|
msgid "Use template"
|
|
msgstr "Usar modelo"
|
|
|
|
#: tfrmfinddlg.caption
|
|
msgctxt "TFRMFINDDLG.CAPTION"
|
|
msgid "Find files"
|
|
msgstr "Localizar arquivos."
|
|
|
|
#: tfrmfinddlg.cbcasesens.caption
|
|
msgid "Case sens&itive"
|
|
msgstr "Sen&sível a maiúsculas."
|
|
|
|
#: tfrmfinddlg.cbdatefrom.caption
|
|
msgid "&Date from:"
|
|
msgstr "&Data desde:"
|
|
|
|
#: tfrmfinddlg.cbdateto.caption
|
|
msgid "Dat&e to:"
|
|
msgstr "Da&ta até:"
|
|
|
|
#: tfrmfinddlg.cbfilesizefrom.caption
|
|
msgid "S&ize from:"
|
|
msgstr "Ta&manho desde:"
|
|
|
|
#: tfrmfinddlg.cbfilesizeto.caption
|
|
msgid "Si&ze to:"
|
|
msgstr "Tam&anho até:"
|
|
|
|
#: tfrmfinddlg.cbfindinarchive.caption
|
|
msgid "Search in &archives"
|
|
msgstr "Pesquisar em arquivos."
|
|
|
|
#: tfrmfinddlg.cbfindtext.caption
|
|
msgctxt "TFRMFINDDLG.CBFINDTEXT.CAPTION"
|
|
msgid "Find &text in file"
|
|
msgstr "Localizar &texto num arquivo."
|
|
|
|
#: tfrmfinddlg.cbfollowsymlinks.caption
|
|
msgctxt "TFRMFINDDLG.CBFOLLOWSYMLINKS.CAPTION"
|
|
msgid "Follow s&ymlinks"
|
|
msgstr "Seguir Links &Simbólicos"
|
|
|
|
#: tfrmfinddlg.cbnotcontainingtext.caption
|
|
msgctxt "TFRMFINDDLG.CBNOTCONTAININGTEXT.CAPTION"
|
|
msgid "Find files N&OT containing the text"
|
|
msgstr "Localizar arquivos S&EM o texto."
|
|
|
|
#: tfrmfinddlg.cbnotolderthan.caption
|
|
msgid "N&ot older than:"
|
|
msgstr "Mais recentes q&ue:"
|
|
|
|
#: tfrmfinddlg.cbopenedtabs.caption
|
|
msgid "Opened tabs"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.cbpartialnamesearch.caption
|
|
msgid "Searc&h for part of file name"
|
|
msgstr "Procurar parte do nome de arquivo."
|
|
|
|
#: tfrmfinddlg.cbregexp.caption
|
|
msgctxt "TFRMFINDDLG.CBREGEXP.CAPTION"
|
|
msgid "&Regular expression"
|
|
msgstr "Expressão ®ular"
|
|
|
|
#: tfrmfinddlg.cbreplacetext.caption
|
|
msgid "Re&place by"
|
|
msgstr "Su&bstituir por"
|
|
|
|
#: tfrmfinddlg.cbselectedfiles.caption
|
|
msgid "Selected directories and &files"
|
|
msgstr "Pastas e &arquivos selecionados."
|
|
|
|
#: tfrmfinddlg.cbtextregexp.caption
|
|
msgid "Regular &expression"
|
|
msgstr "Expressão regular"
|
|
|
|
#: tfrmfinddlg.cbtimefrom.caption
|
|
msgid "&Time from:"
|
|
msgstr "&Hora desde:"
|
|
|
|
#: tfrmfinddlg.cbtimeto.caption
|
|
msgid "Ti&me to:"
|
|
msgstr "H&ora até:"
|
|
|
|
#: tfrmfinddlg.cbuseplugin.caption
|
|
msgid "&Use search plugin:"
|
|
msgstr "&Usar plugin de procura"
|
|
|
|
#: tfrmfinddlg.chkhex.caption
|
|
msgid "Hexadecimal"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.cmbexcludedirectories.hint
|
|
msgid "Enter directories names that should be excluded from search separated with \";\""
|
|
msgstr "Introduza os nomes das pastas a excluir da procura separados por \";\""
|
|
|
|
#: tfrmfinddlg.cmbexcludefiles.hint
|
|
msgid "Enter files names that should be excluded from search separated with \";\""
|
|
msgstr "Introduza os nomes dos arquivos a excluir da procura, separados por \";\""
|
|
|
|
#: tfrmfinddlg.cmbfindfilemask.hint
|
|
msgid "Enter files names separated with \";\""
|
|
msgstr "Introduza os nomes de arquivos separados por \";\""
|
|
|
|
#: tfrmfinddlg.gbdirectories.caption
|
|
msgctxt "TFRMFINDDLG.GBDIRECTORIES.CAPTION"
|
|
msgid "Directories"
|
|
msgstr "Pastas"
|
|
|
|
#: tfrmfinddlg.gbfiles.caption
|
|
msgctxt "TFRMFINDDLG.GBFILES.CAPTION"
|
|
msgid "Files"
|
|
msgstr "Arquivos"
|
|
|
|
#: tfrmfinddlg.gbfinddata.caption
|
|
msgctxt "tfrmfinddlg.gbfinddata.caption"
|
|
msgid "Find Data"
|
|
msgstr "Localizar Dados"
|
|
|
|
#: tfrmfinddlg.lblattributes.caption
|
|
msgctxt "TFRMFINDDLG.LBLATTRIBUTES.CAPTION"
|
|
msgid "Attri&butes"
|
|
msgstr "Atri&butos"
|
|
|
|
#: tfrmfinddlg.lblencoding.caption
|
|
msgctxt "TFRMFINDDLG.LBLENCODING.CAPTION"
|
|
msgid "Encodin&g:"
|
|
msgstr "Co&dificar"
|
|
|
|
#: tfrmfinddlg.lblexcludedirectories.caption
|
|
msgid "E&xclude subdirectories"
|
|
msgstr "E&xcluir subpastas"
|
|
|
|
#: tfrmfinddlg.lblexcludefiles.caption
|
|
msgid "&Exclude files"
|
|
msgstr "&Excluir arquivos"
|
|
|
|
#: tfrmfinddlg.lblfindfilemask.caption
|
|
msgid "&File mask"
|
|
msgstr "Máscara de &arquivo"
|
|
|
|
#: tfrmfinddlg.lblfindpathstart.caption
|
|
msgid "Start in &directory"
|
|
msgstr "Iniciar na &pasta"
|
|
|
|
#: tfrmfinddlg.lblsearchdepth.caption
|
|
msgid "Search su&bdirectories:"
|
|
msgstr "Procurar em su&bpastas"
|
|
|
|
#: tfrmfinddlg.lbltemplateheader.caption
|
|
msgid "&Previous searches:"
|
|
msgstr "Procurar &anterior"
|
|
|
|
#: tfrmfinddlg.miaction.caption
|
|
msgid "&Action"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.mifreefrommemallothers.caption
|
|
msgid "For all others, cancel, close and free from memory"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.miopeninnewtab.caption
|
|
msgid "Open In New Tab(s)"
|
|
msgstr "Abrir em Nova(s) Guia(s)"
|
|
|
|
#: tfrmfinddlg.mioptions.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfinddlg.mioptions.caption"
|
|
msgid "Options"
|
|
msgstr "Opções"
|
|
|
|
#: tfrmfinddlg.miremovefromllist.caption
|
|
msgid "Remove from list"
|
|
msgstr "Remover da lista"
|
|
|
|
#: tfrmfinddlg.miresult.caption
|
|
msgid "&Result"
|
|
msgstr ""
|
|
|
|
#: tfrmfinddlg.mishowallfound.caption
|
|
msgid "Show all found items"
|
|
msgstr "Mostrar todos os itens encontrados."
|
|
|
|
#: tfrmfinddlg.mishowineditor.caption
|
|
msgid "Show In Editor"
|
|
msgstr "Mostrar no Editor."
|
|
|
|
#: tfrmfinddlg.mishowinviewer.caption
|
|
msgid "Show In Viewer"
|
|
msgstr "Mostrar no visualizador."
|
|
|
|
#: tfrmfinddlg.miviewtab.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmfinddlg.miviewtab.caption"
|
|
msgid "&View"
|
|
msgstr "&Ver"
|
|
|
|
#: tfrmfinddlg.tsadvanced.caption
|
|
msgid "Advanced"
|
|
msgstr "Avançado"
|
|
|
|
#: tfrmfinddlg.tsloadsave.caption
|
|
msgid "Load/Save"
|
|
msgstr "Carregar/Salvar"
|
|
|
|
#: tfrmfinddlg.tsplugins.caption
|
|
msgctxt "TFRMFINDDLG.TSPLUGINS.CAPTION"
|
|
msgid "Plugins"
|
|
msgstr "Suplementos"
|
|
|
|
#: tfrmfinddlg.tsresults.caption
|
|
msgid "Results"
|
|
msgstr "Resultados"
|
|
|
|
#: tfrmfinddlg.tsstandard.caption
|
|
msgid "Standard"
|
|
msgstr "Padrão"
|
|
|
|
#: tfrmfindview.btnclose.caption
|
|
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmfindview.btnfind.caption
|
|
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
|
|
msgid "&Find"
|
|
msgstr "&Localizar"
|
|
|
|
#: tfrmfindview.caption
|
|
msgctxt "TFRMFINDVIEW.CAPTION"
|
|
msgid "Find"
|
|
msgstr "Localizar"
|
|
|
|
#: tfrmfindview.cbcasesens.caption
|
|
msgid "C&ase sensitive"
|
|
msgstr "Sensível a m&aiúsculas"
|
|
|
|
#: tfrmhardlink.btncancel.caption
|
|
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmhardlink.btnok.caption
|
|
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmhardlink.caption
|
|
msgid "Create hard link"
|
|
msgstr "Criar link físico."
|
|
|
|
#: tfrmhardlink.lblexistingfile.caption
|
|
msgctxt "TFRMHARDLINK.LBLEXISTINGFILE.CAPTION"
|
|
msgid "&Destination that the link will point to"
|
|
msgstr "&Destino para onde o link irá apontar."
|
|
|
|
#: tfrmhardlink.lbllinktocreate.caption
|
|
msgctxt "TFRMHARDLINK.LBLLINKTOCREATE.CAPTION"
|
|
msgid "&Link name"
|
|
msgstr "Nome do &Link"
|
|
|
|
#: tfrmhotdirexportimport.btnselectall.caption
|
|
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
|
|
msgid "Import all!"
|
|
msgstr "Importar todos!"
|
|
|
|
#: tfrmhotdirexportimport.btnselectiondone.caption
|
|
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
|
|
msgid "Import selected"
|
|
msgstr "Importar selecionado"
|
|
|
|
#: tfrmhotdirexportimport.caption
|
|
msgid "Select the entries your want to import"
|
|
msgstr "Selecionar as entradas que você quer importar."
|
|
|
|
#: tfrmhotdirexportimport.lbhint.caption
|
|
msgid "When clicking a sub-menu, it will select the whole menu"
|
|
msgstr "Ao clicar no submenu, será selecionado todo o menu."
|
|
|
|
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
|
|
msgid "Hold CTRL and click entries to select multiple ones"
|
|
msgstr "Segure CTRL e clique nas entradas para selecionar várias."
|
|
|
|
#: tfrmlinker.btnsave.caption
|
|
msgctxt "TFRMLINKER.BTNSAVE.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmlinker.caption
|
|
msgctxt "TFRMLINKER.CAPTION"
|
|
msgid "Linker"
|
|
msgstr "Ligador "
|
|
|
|
#: tfrmlinker.gbsaveto.caption
|
|
msgid "Save to..."
|
|
msgstr "Salvar para..."
|
|
|
|
#: tfrmlinker.grbxcontrol.caption
|
|
msgid "Item"
|
|
msgstr "Item"
|
|
|
|
#: tfrmlinker.lblfilename.caption
|
|
msgctxt "TFRMLINKER.LBLFILENAME.CAPTION"
|
|
msgid "&File name"
|
|
msgstr "Nome de &arquivo"
|
|
|
|
#: tfrmlinker.spbtndown.caption
|
|
msgctxt "TFRMLINKER.SPBTNDOWN.CAPTION"
|
|
msgid "Do&wn"
|
|
msgstr "A&baixo"
|
|
|
|
#: tfrmlinker.spbtndown.hint
|
|
msgctxt "TFRMLINKER.SPBTNDOWN.HINT"
|
|
msgid "Down"
|
|
msgstr "Abaixo"
|
|
|
|
#: tfrmlinker.spbtnrem.caption
|
|
msgctxt "tfrmlinker.spbtnrem.caption"
|
|
msgid "&Remove"
|
|
msgstr "&Remover"
|
|
|
|
#: tfrmlinker.spbtnrem.hint
|
|
msgctxt "tfrmlinker.spbtnrem.hint"
|
|
msgid "Delete"
|
|
msgstr "Excluir"
|
|
|
|
#: tfrmlinker.spbtnup.caption
|
|
msgctxt "TFRMLINKER.SPBTNUP.CAPTION"
|
|
msgid "&Up"
|
|
msgstr "A&cima"
|
|
|
|
#: tfrmlinker.spbtnup.hint
|
|
msgctxt "TFRMLINKER.SPBTNUP.HINT"
|
|
msgid "Up"
|
|
msgstr "Acima"
|
|
|
|
#: tfrmmain.actabout.caption
|
|
msgctxt "TFRMMAIN.ACTABOUT.CAPTION"
|
|
msgid "&About"
|
|
msgstr "&Sobre"
|
|
|
|
#: tfrmmain.actaddfilenametocmdline.caption
|
|
msgid "Add file name to command line"
|
|
msgstr "Adicionar nome de arquivo à linha de comandos."
|
|
|
|
#: tfrmmain.actaddnewsearch.caption
|
|
msgid "New search instance..."
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actaddpathandfilenametocmdline.caption
|
|
msgid "Add path and file name to command line"
|
|
msgstr "Adicionar caminho e nome de arquivo à linha de comandos."
|
|
|
|
#: tfrmmain.actaddpathtocmdline.caption
|
|
msgid "Copy path to command line"
|
|
msgstr "Copiar caminho para a linha de comandos."
|
|
|
|
#: tfrmmain.actbenchmark.caption
|
|
msgid "&Benchmark"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actbriefview.caption
|
|
msgctxt "tfrmmain.actbriefview.caption"
|
|
msgid "Brief view"
|
|
msgstr "Visão resumida"
|
|
|
|
#: tfrmmain.actbriefview.hint
|
|
msgid "Brief View"
|
|
msgstr "Visão Resumida"
|
|
|
|
#: tfrmmain.actcalculatespace.caption
|
|
msgid "Calculate &Occupied Space"
|
|
msgstr "Calcular Espaço &Ocupado"
|
|
|
|
#: tfrmmain.actchangedir.caption
|
|
msgid "Change directory"
|
|
msgstr "Alterar pasta"
|
|
|
|
#: tfrmmain.actchangedirtohome.caption
|
|
msgid "Change directory to home"
|
|
msgstr "Trocar pasta para raiz"
|
|
|
|
#: tfrmmain.actchangedirtoparent.caption
|
|
msgid "Change Directory To Parent"
|
|
msgstr "Alterar pasta para pasta-mãe."
|
|
|
|
#: tfrmmain.actchangedirtoroot.caption
|
|
msgid "Change directory to root"
|
|
msgstr "Alterar pasta para raíz."
|
|
|
|
#: tfrmmain.actchecksumcalc.caption
|
|
msgctxt "TFRMMAIN.ACTCHECKSUMCALC.CAPTION"
|
|
msgid "Calculate Check&sum..."
|
|
msgstr "Calcular check&sum..."
|
|
|
|
#: tfrmmain.actchecksumverify.caption
|
|
msgctxt "TFRMMAIN.ACTCHECKSUMVERIFY.CAPTION"
|
|
msgid "&Verify Checksum..."
|
|
msgstr "&Verificar checksum..."
|
|
|
|
#: tfrmmain.actclearlogfile.caption
|
|
msgid "Clear log file"
|
|
msgstr "Limpar arquivo de log."
|
|
|
|
#: tfrmmain.actclearlogwindow.caption
|
|
msgid "Clear log window"
|
|
msgstr "Limpar janela de log."
|
|
|
|
#: tfrmmain.actclosealltabs.caption
|
|
msgctxt "TFRMMAIN.ACTCLOSEALLTABS.CAPTION"
|
|
msgid "Close &All Tabs"
|
|
msgstr "Fech&ar todas as Guias."
|
|
|
|
#: tfrmmain.actcloseduplicatetabs.caption
|
|
msgid "Close Duplicate Tabs"
|
|
msgstr "Fechar Guias Duplicatas."
|
|
|
|
#: tfrmmain.actclosetab.caption
|
|
msgctxt "TFRMMAIN.ACTCLOSETAB.CAPTION"
|
|
msgid "&Close Tab"
|
|
msgstr "Fe&char Guia"
|
|
|
|
#: tfrmmain.actcmdlinenext.caption
|
|
msgid "Next Command Line"
|
|
msgstr "Linha de comandos seguinte."
|
|
|
|
#: tfrmmain.actcmdlinenext.hint
|
|
msgid "Set command line to next command in history"
|
|
msgstr "Definir linha de comandos para o comando seguinte do histórico."
|
|
|
|
#: tfrmmain.actcmdlineprev.caption
|
|
msgid "Previous Command Line"
|
|
msgstr "Linha de comandos anterior."
|
|
|
|
#: tfrmmain.actcmdlineprev.hint
|
|
msgid "Set command line to previous command in history"
|
|
msgstr "Definir linha de comandos para o comando anterior do histórico."
|
|
|
|
#: tfrmmain.actcolumnsview.caption
|
|
msgid "Full"
|
|
msgstr "Completo"
|
|
|
|
#: tfrmmain.actcolumnsview.hint
|
|
msgid "Columns View"
|
|
msgstr "Visão de colunas."
|
|
|
|
#: tfrmmain.actcomparecontents.caption
|
|
msgid "Compare by &Contents"
|
|
msgstr "&Comparar por conteúdos."
|
|
|
|
#: tfrmmain.actcomparedirectories.caption
|
|
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.CAPTION"
|
|
msgid "Compare Directories"
|
|
msgstr "Comparar pastas."
|
|
|
|
#: tfrmmain.actcomparedirectories.hint
|
|
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
|
|
msgid "Compare Directories"
|
|
msgstr "Comparar pastas."
|
|
|
|
#: tfrmmain.actconfigarchivers.caption
|
|
msgid "Configuration of Archivers"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigdirhotlist.caption
|
|
msgctxt "tfrmmain.actconfigdirhotlist.caption"
|
|
msgid "Configuration of Directory Hotlist"
|
|
msgstr "Configuração da pasta Hotlist."
|
|
|
|
#: tfrmmain.actconfigfavoritetabs.caption
|
|
msgid "Configuration of Favorite Tabs"
|
|
msgstr "Configuração das Guias de Favoritos"
|
|
|
|
#: tfrmmain.actconfigfoldertabs.caption
|
|
msgid "Configuration of folder tabs"
|
|
msgstr "Configuração das Guias de Pastas."
|
|
|
|
#: tfrmmain.actconfighotkeys.caption
|
|
msgctxt "tfrmmain.actconfighotkeys.caption"
|
|
msgid "Configuration of hot keys"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigsavesettings.caption
|
|
msgid "Save Settings"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigsearches.caption
|
|
msgid "Configuration of searches"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigtoolbars.caption
|
|
msgid "Toolbar..."
|
|
msgstr "Barra de Ferramentas"
|
|
|
|
#: tfrmmain.actconfigtreeviewmenus.caption
|
|
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
|
|
msgid "Configuration of Tree View Menu"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actconfigtreeviewmenuscolors.caption
|
|
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
|
|
msgid "Configuration of Tree View Menu Colors"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actcontextmenu.caption
|
|
msgid "Show context menu"
|
|
msgstr "Mostrar menu de contexto."
|
|
|
|
#: tfrmmain.actcopy.caption
|
|
msgctxt "tfrmmain.actcopy.caption"
|
|
msgid "Copy"
|
|
msgstr "Copiar"
|
|
|
|
#: tfrmmain.actcopyalltabstoopposite.caption
|
|
msgid "Copy all tabs to opposite side"
|
|
msgstr "Copiar todas guias para lado oposto."
|
|
|
|
#: tfrmmain.actcopyfiledetailstoclip.caption
|
|
msgid "Copy all shown &columns"
|
|
msgstr "Copiar todas &colunas mostradas."
|
|
|
|
#: tfrmmain.actcopyfullnamestoclip.caption
|
|
msgid "Copy Filename(s) with Full &Path"
|
|
msgstr "Copiar nomes de arquivos com caminho com&pleto."
|
|
|
|
#: tfrmmain.actcopynamestoclip.caption
|
|
msgid "Copy &Filename(s) to Clipboard"
|
|
msgstr "Copiar nomes de &arquivos para a área de transferência."
|
|
|
|
#: tfrmmain.actcopynoask.caption
|
|
msgid "Copy files without asking for confirmation"
|
|
msgstr "Copiar arquivos sem pedir confirmação."
|
|
|
|
#: tfrmmain.actcopypathnosepoffilestoclip.caption
|
|
msgid "Copy Full Path of selected file(s) with no ending dir separator"
|
|
msgstr "Copiar caminho completo do(s) arquivo(s) selecionado(s) sem guia de pasta."
|
|
|
|
#: tfrmmain.actcopypathoffilestoclip.caption
|
|
msgid "Copy Full Path of selected file(s)"
|
|
msgstr "Copiar caminho completo do(s) arquivo(s) selecionado(s)."
|
|
|
|
#: tfrmmain.actcopysamepanel.caption
|
|
msgid "Copy to same panel"
|
|
msgstr "Copiar para o mesmo painel."
|
|
|
|
#: tfrmmain.actcopytoclipboard.caption
|
|
msgid "&Copy"
|
|
msgstr "&Copiar"
|
|
|
|
#: tfrmmain.actcountdircontent.caption
|
|
msgid "Sho&w Occupied Space"
|
|
msgstr "Mostrar espaço oc&upado."
|
|
|
|
#: tfrmmain.actcuttoclipboard.caption
|
|
msgid "Cu&t"
|
|
msgstr "Cor&tar"
|
|
|
|
#: tfrmmain.actdebugshowcommandparameters.caption
|
|
msgid "Show Command Parameters"
|
|
msgstr "Mostrar Parâmetros de Comandos."
|
|
|
|
#: tfrmmain.actdelete.caption
|
|
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "Excluir"
|
|
|
|
#: tfrmmain.actdeletesearches.caption
|
|
msgid "For all searches, cancel, close and free memory"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actdirhistory.caption
|
|
msgctxt "TFRMMAIN.ACTDIRHISTORY.CAPTION"
|
|
msgid "Directory history"
|
|
msgstr "Histórico da pasta"
|
|
|
|
#: tfrmmain.actdirhotlist.caption
|
|
msgid "Directory &Hotlist"
|
|
msgstr "Pasta Hotlist"
|
|
|
|
#: tfrmmain.actdoanycmcommand.caption
|
|
msgid "Select any command and execute it"
|
|
msgstr "Selecionar qualquer comando e executá-lo."
|
|
|
|
#: tfrmmain.actedit.caption
|
|
msgctxt "tfrmmain.actedit.caption"
|
|
msgid "Edit"
|
|
msgstr "Editar"
|
|
|
|
#: tfrmmain.acteditcomment.caption
|
|
msgid "Edit Co&mment..."
|
|
msgstr "Editar c&omentário."
|
|
|
|
#: tfrmmain.acteditnew.caption
|
|
msgid "Edit new file"
|
|
msgstr "Editar novo arquivo."
|
|
|
|
#: tfrmmain.acteditpath.caption
|
|
msgid "Edit path field above file list"
|
|
msgstr "Editar campo de caminho acima da lista de arquivos."
|
|
|
|
#: tfrmmain.actexchange.caption
|
|
msgid "Swap &Panels"
|
|
msgstr "Trocar &painéis"
|
|
|
|
#: tfrmmain.actexecutescript.caption
|
|
msgid "Execute Script"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actexit.caption
|
|
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
|
|
msgid "E&xit"
|
|
msgstr "&Sair"
|
|
|
|
#: tfrmmain.actextractfiles.caption
|
|
msgid "&Extract Files..."
|
|
msgstr "&Extrair arquivos..."
|
|
|
|
#: tfrmmain.actfileassoc.caption
|
|
msgid "Configuration of File &Associations"
|
|
msgstr "Configuração de &Associações de arquivos."
|
|
|
|
#: tfrmmain.actfilelinker.caption
|
|
msgid "Com&bine Files..."
|
|
msgstr "Com&binar Arquivos..."
|
|
|
|
#: tfrmmain.actfileproperties.caption
|
|
msgid "Show &File Properties"
|
|
msgstr "Mostrar Propriedades de &Arquivo"
|
|
|
|
#: tfrmmain.actfilespliter.caption
|
|
msgctxt "TFRMMAIN.ACTFILESPLITER.CAPTION"
|
|
msgid "Spl&it File..."
|
|
msgstr "D&ividir Arquivo..."
|
|
|
|
#: tfrmmain.actflatview.caption
|
|
msgid "&Flat view"
|
|
msgstr "Visão &Plana"
|
|
|
|
#: tfrmmain.actfocuscmdline.caption
|
|
msgid "Focus command line"
|
|
msgstr "Foco na linha de comandos."
|
|
|
|
#: tfrmmain.actfocusswap.caption
|
|
msgid "Swap focus"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actfocusswap.hint
|
|
msgid "Switch between left and right file list"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actgotofirstfile.caption
|
|
msgid "Place cursor on first file in list"
|
|
msgstr "Colocar cursor no primeiro arquivo da lista."
|
|
|
|
#: tfrmmain.actgotolastfile.caption
|
|
msgid "Place cursor on last file in list"
|
|
msgstr "Colocar cursor no último arquivo da lista."
|
|
|
|
#: tfrmmain.acthardlink.caption
|
|
msgctxt "TFRMMAIN.ACTHARDLINK.CAPTION"
|
|
msgid "Create &Hard Link..."
|
|
msgstr "Criar li&gação física."
|
|
|
|
#: tfrmmain.acthelpindex.caption
|
|
msgid "&Contents"
|
|
msgstr "&Conteúdo"
|
|
|
|
#: tfrmmain.acthorizontalfilepanels.caption
|
|
msgid "&Horizontal Panels Mode"
|
|
msgstr "Modo Painéis &horizontais."
|
|
|
|
#: tfrmmain.actkeyboard.caption
|
|
msgid "&Keyboard"
|
|
msgstr "&Teclado"
|
|
|
|
#: tfrmmain.actleftbriefview.caption
|
|
msgid "Brief view on left panel"
|
|
msgstr "Visão resumida no painel esquerdo."
|
|
|
|
#: tfrmmain.actleftcolumnsview.caption
|
|
msgid "Columns view on left panel"
|
|
msgstr "Visão de colunas no painel esquerdo."
|
|
|
|
#: tfrmmain.actleftequalright.caption
|
|
msgid "Left &= Right"
|
|
msgstr "Esquerdo &= Direito"
|
|
|
|
#: tfrmmain.actleftflatview.caption
|
|
msgid "&Flat view on left panel"
|
|
msgstr "Visão plana no painel esquerdo."
|
|
|
|
#: tfrmmain.actleftopendrives.caption
|
|
msgid "Open left drive list"
|
|
msgstr "Abrir lista esquerda de unidades."
|
|
|
|
#: tfrmmain.actleftreverseorder.caption
|
|
msgid "Re&verse order on left panel"
|
|
msgstr "In&verter ordem no painel esquerdo."
|
|
|
|
#: tfrmmain.actleftsortbyattr.caption
|
|
msgid "Sort left panel by &Attributes"
|
|
msgstr "Ordenar painel esquerdo por atributos."
|
|
|
|
#: tfrmmain.actleftsortbydate.caption
|
|
msgid "Sort left panel by &Date"
|
|
msgstr "Ordenar painel esquerdo por &Data\""
|
|
|
|
#: tfrmmain.actleftsortbyext.caption
|
|
msgid "Sort left panel by &Extension"
|
|
msgstr "Ordenar painal esquerdo por &Extensão."
|
|
|
|
#: tfrmmain.actleftsortbyname.caption
|
|
msgid "Sort left panel by &Name"
|
|
msgstr "Ordenar painal esquerdo por &Nome."
|
|
|
|
#: tfrmmain.actleftsortbysize.caption
|
|
msgid "Sort left panel by &Size"
|
|
msgstr "Ordenar painal esquerdo por &Tamanho."
|
|
|
|
#: tfrmmain.actleftthumbview.caption
|
|
msgid "Thumbnails view on left panel"
|
|
msgstr "Visão miniaturas no painel esquerdo."
|
|
|
|
#: tfrmmain.actloadfavoritetabs.caption
|
|
msgid "Load tabs from Favorite Tabs"
|
|
msgstr "Carregar guias da Guia Favoritos."
|
|
|
|
#: tfrmmain.actloadselectionfromclip.caption
|
|
msgid "Load Selection from Clip&board"
|
|
msgstr "Carregar seleção da área de transferência."
|
|
|
|
#: tfrmmain.actloadselectionfromfile.caption
|
|
msgid "&Load Selection from File..."
|
|
msgstr "Carregar se&leção de arquivo."
|
|
|
|
#: tfrmmain.actloadtabs.caption
|
|
msgid "&Load Tabs from File"
|
|
msgstr "&Carregar guias de Arquivo."
|
|
|
|
#: tfrmmain.actmakedir.caption
|
|
msgid "Create &Directory"
|
|
msgstr "Criar &Pasta"
|
|
|
|
#: tfrmmain.actmarkcurrentextension.caption
|
|
msgid "Select All with the Same E&xtension"
|
|
msgstr "Selecionar todos com a mesma e&xtensão."
|
|
|
|
#: tfrmmain.actmarkcurrentname.caption
|
|
msgid "Select all files with same name"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actmarkcurrentnameext.caption
|
|
msgid "Select all files with same name and extension"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actmarkcurrentpath.caption
|
|
msgid "Select all in same path"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actmarkinvert.caption
|
|
msgid "&Invert Selection"
|
|
msgstr "&Inverter seleção"
|
|
|
|
#: tfrmmain.actmarkmarkall.caption
|
|
msgid "&Select All"
|
|
msgstr "&Selecionar tudo"
|
|
|
|
#: tfrmmain.actmarkminus.caption
|
|
msgid "Unselect a Gro&up..."
|
|
msgstr "Remover seleção de um grupo"
|
|
|
|
#: tfrmmain.actmarkplus.caption
|
|
msgid "Select a &Group..."
|
|
msgstr "Selecionar um &grupo"
|
|
|
|
#: tfrmmain.actmarkunmarkall.caption
|
|
msgid "&Unselect All"
|
|
msgstr "Rem&over todas as seleções"
|
|
|
|
#: tfrmmain.actminimize.caption
|
|
msgid "Minimize window"
|
|
msgstr "Minimizar janela"
|
|
|
|
#: tfrmmain.actmultirename.caption
|
|
msgid "Multi &Rename Tool"
|
|
msgstr "Ferramenta Multirenomear"
|
|
|
|
#: tfrmmain.actnetworkconnect.caption
|
|
msgid "Network &Connect..."
|
|
msgstr "Conectar a &rede"
|
|
|
|
#: tfrmmain.actnetworkdisconnect.caption
|
|
msgid "Network &Disconnect"
|
|
msgstr "Descone&ctar da rede"
|
|
|
|
#: tfrmmain.actnetworkquickconnect.caption
|
|
msgid "Network &Quick Connect..."
|
|
msgstr "Conexão &rápida a rede"
|
|
|
|
#: tfrmmain.actnewtab.caption
|
|
msgid "&New Tab"
|
|
msgstr "&Nova Guia"
|
|
|
|
#: tfrmmain.actnextfavoritetabs.caption
|
|
msgid "Load the Next Favorite Tabs in the list"
|
|
msgstr "Carregar a próxima Guia Favoritos na lista."
|
|
|
|
#: tfrmmain.actnexttab.caption
|
|
msgid "Switch to Nex&t Tab"
|
|
msgstr "Mudar para a guia seguinte."
|
|
|
|
#: tfrmmain.actopen.caption
|
|
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
|
|
msgid "Open"
|
|
msgstr "Abrir"
|
|
|
|
#: tfrmmain.actopenarchive.caption
|
|
msgid "Try open archive"
|
|
msgstr "Tentar abrir arquivo"
|
|
|
|
#: tfrmmain.actopenbar.caption
|
|
msgid "Open bar file"
|
|
msgstr "Abrir arquivo barra"
|
|
|
|
#: tfrmmain.actopendirinnewtab.caption
|
|
msgid "Open &Folder in a New Tab"
|
|
msgstr "Abrir &pasta em nova guia"
|
|
|
|
#: tfrmmain.actopenvirtualfilesystemlist.caption
|
|
msgctxt "TFRMMAIN.ACTOPENVIRTUALFILESYSTEMLIST.CAPTION"
|
|
msgid "Open &VFS List"
|
|
msgstr "Abrir lista do SVF"
|
|
|
|
#: tfrmmain.actoperationsviewer.caption
|
|
msgid "Operations &Viewer"
|
|
msgstr "&Visualizador de operações"
|
|
|
|
#: tfrmmain.actoptions.caption
|
|
msgid "&Options..."
|
|
msgstr "&Opções..."
|
|
|
|
#: tfrmmain.actpackfiles.caption
|
|
msgid "&Pack Files..."
|
|
msgstr "&Comprimir arquivos"
|
|
|
|
#: tfrmmain.actpanelssplitterperpos.caption
|
|
msgid "Set splitter position"
|
|
msgstr "Definir posição do divisor"
|
|
|
|
#: tfrmmain.actpastefromclipboard.caption
|
|
msgid "&Paste"
|
|
msgstr "Co&lar"
|
|
|
|
#: tfrmmain.actpreviousfavoritetabs.caption
|
|
msgid "Load the Previous Favorite Tabs in the list"
|
|
msgstr "Carregar Guia de Favoritos Anteror na lista."
|
|
|
|
#: tfrmmain.actprevtab.caption
|
|
msgid "Switch to &Previous Tab"
|
|
msgstr "Mudar para o se¶dor anterior."
|
|
|
|
#: tfrmmain.actquickfilter.caption
|
|
msgid "Quick filter"
|
|
msgstr "Filtro rápido"
|
|
|
|
#: tfrmmain.actquicksearch.caption
|
|
msgctxt "TFRMMAIN.ACTQUICKSEARCH.CAPTION"
|
|
msgid "Quick search"
|
|
msgstr "Procura rápida"
|
|
|
|
#: tfrmmain.actquickview.caption
|
|
msgid "&Quick View Panel"
|
|
msgstr "Painel de visualização rápida"
|
|
|
|
#: tfrmmain.actrefresh.caption
|
|
msgid "&Refresh"
|
|
msgstr "&Atualizar"
|
|
|
|
#: tfrmmain.actreloadfavoritetabs.caption
|
|
msgid "Reload the last Favorite Tabs loaded"
|
|
msgstr "Recarregar a última guia Favoritos carregada."
|
|
|
|
#: tfrmmain.actrename.caption
|
|
msgctxt "tfrmmain.actrename.caption"
|
|
msgid "Move"
|
|
msgstr "Mover"
|
|
|
|
#: tfrmmain.actrenamenoask.caption
|
|
msgid "Move/Rename files without asking for confirmation"
|
|
msgstr "Mover/Renomear arquivos sem pedir confirmação."
|
|
|
|
#: tfrmmain.actrenameonly.caption
|
|
msgctxt "TFRMMAIN.ACTRENAMEONLY.CAPTION"
|
|
msgid "Rename"
|
|
msgstr "Renomear"
|
|
|
|
#: tfrmmain.actrenametab.caption
|
|
msgid "&Rename Tab"
|
|
msgstr "&Renomear Guia"
|
|
|
|
#: tfrmmain.actresavefavoritetabs.caption
|
|
msgid "Resave on the last Favorite Tabs loaded"
|
|
msgstr "Resalvar nas últimas guias Favoritos carregadas."
|
|
|
|
#: tfrmmain.actrestoreselection.caption
|
|
msgid "&Restore Selection"
|
|
msgstr "R&estaurar seleção"
|
|
|
|
#: tfrmmain.actreverseorder.caption
|
|
msgid "Re&verse Order"
|
|
msgstr "&Inverter ordem"
|
|
|
|
#: tfrmmain.actrightbriefview.caption
|
|
msgid "Brief view on right panel"
|
|
msgstr "Visão resumida do painel direito."
|
|
|
|
#: tfrmmain.actrightcolumnsview.caption
|
|
msgid "Columns view on right panel"
|
|
msgstr "Visão colunas no painel direito."
|
|
|
|
#: tfrmmain.actrightequalleft.caption
|
|
msgid "Right &= Left"
|
|
msgstr "Direito &= Esquerdo."
|
|
|
|
#: tfrmmain.actrightflatview.caption
|
|
msgid "&Flat view on right panel"
|
|
msgstr "Visão plana no painel direito."
|
|
|
|
#: tfrmmain.actrightopendrives.caption
|
|
msgid "Open right drive list"
|
|
msgstr "Abrir lista direita de unidades."
|
|
|
|
#: tfrmmain.actrightreverseorder.caption
|
|
msgid "Re&verse order on right panel"
|
|
msgstr "Inverter ordem no painel direito."
|
|
|
|
#: tfrmmain.actrightsortbyattr.caption
|
|
msgid "Sort right panel by &Attributes"
|
|
msgstr "Ordenar painel direito por &Atributos."
|
|
|
|
#: tfrmmain.actrightsortbydate.caption
|
|
msgid "Sort right panel by &Date"
|
|
msgstr "Ordenar painel direito por &Data."
|
|
|
|
#: tfrmmain.actrightsortbyext.caption
|
|
msgid "Sort right panel by &Extension"
|
|
msgstr "Ordenar painel direito por &Extensão."
|
|
|
|
#: tfrmmain.actrightsortbyname.caption
|
|
msgid "Sort right panel by &Name"
|
|
msgstr "Ordenar painel direito por &Nome."
|
|
|
|
#: tfrmmain.actrightsortbysize.caption
|
|
msgid "Sort right panel by &Size"
|
|
msgstr "Ordenar painel direito por &Tamanho."
|
|
|
|
#: tfrmmain.actrightthumbview.caption
|
|
msgid "Thumbnails view on right panel"
|
|
msgstr "Visão miniatura no painel direito"
|
|
|
|
#: tfrmmain.actrunterm.caption
|
|
msgid "Run &Terminal"
|
|
msgstr "Executar &terminal"
|
|
|
|
#: tfrmmain.actsavefavoritetabs.caption
|
|
msgid "Save current tabs to a New Favorite Tabs"
|
|
msgstr "Salvar guias atuais para uma nova guia Favoritos."
|
|
|
|
#: tfrmmain.actsaveselection.caption
|
|
msgid "Sa&ve Selection"
|
|
msgstr "Gra&var seleção"
|
|
|
|
#: tfrmmain.actsaveselectiontofile.caption
|
|
msgid "Save S&election to File..."
|
|
msgstr "Salvar s&eleção para arquivo..."
|
|
|
|
#: tfrmmain.actsavetabs.caption
|
|
msgid "&Save Tabs to File"
|
|
msgstr "Salvar guias para arquivo"
|
|
|
|
#: tfrmmain.actsearch.caption
|
|
msgid "&Search..."
|
|
msgstr "&Localizar..."
|
|
|
|
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
|
|
msgid "All tabs Locked with Dir Opened in New Tabs"
|
|
msgstr "Todas as guias Bloqueadas com Dir Aberto em Novas guias."
|
|
|
|
#: tfrmmain.actsetalltabsoptionnormal.caption
|
|
msgid "Set all tabs to Normal"
|
|
msgstr "Definir todas as guias como Normal."
|
|
|
|
#: tfrmmain.actsetalltabsoptionpathlocked.caption
|
|
msgid "Set all tabs to Locked"
|
|
msgstr "Definir todas as guias como Bloqueadas."
|
|
|
|
#: tfrmmain.actsetalltabsoptionpathresets.caption
|
|
msgid "All tabs Locked with Dir Changes Allowed"
|
|
msgstr "Todas guias bloqueadas com Alterações de Dir Permitidas."
|
|
|
|
#: tfrmmain.actsetfileproperties.caption
|
|
msgctxt "TFRMMAIN.ACTSETFILEPROPERTIES.CAPTION"
|
|
msgid "Change &Attributes..."
|
|
msgstr "Alterar &atributos"
|
|
|
|
#: tfrmmain.actsettaboptiondirsinnewtab.caption
|
|
msgid "Locked with Directories Opened in New &Tabs"
|
|
msgstr "Bloqueado com pastas abertas em novos guias."
|
|
|
|
#: tfrmmain.actsettaboptionnormal.caption
|
|
msgid "&Normal"
|
|
msgstr "&Normal"
|
|
|
|
#: tfrmmain.actsettaboptionpathlocked.caption
|
|
msgid "&Locked"
|
|
msgstr "&Bloqueado"
|
|
|
|
#: tfrmmain.actsettaboptionpathresets.caption
|
|
msgctxt "TFRMMAIN.ACTSETTABOPTIONPATHRESETS.CAPTION"
|
|
msgid "Locked with &Directory Changes Allowed"
|
|
msgstr "Bloqueado com alterações de &pastas permitidas."
|
|
|
|
#: tfrmmain.actshellexecute.caption
|
|
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
|
|
msgid "Open"
|
|
msgstr "Abrir"
|
|
|
|
#: tfrmmain.actshellexecute.hint
|
|
msgid "Open using system associations"
|
|
msgstr "Abrir usando associações do sistema."
|
|
|
|
#: tfrmmain.actshowbuttonmenu.caption
|
|
msgid "Show button menu"
|
|
msgstr "Mostrar menu de botões"
|
|
|
|
#: tfrmmain.actshowcmdlinehistory.caption
|
|
msgid "Show command line history"
|
|
msgstr "Mostrar histórico da linha de comandos."
|
|
|
|
#: tfrmmain.actshowmainmenu.caption
|
|
msgctxt "TFRMMAIN.ACTSHOWMAINMENU.CAPTION"
|
|
msgid "Menu"
|
|
msgstr "Menu"
|
|
|
|
#: tfrmmain.actshowsysfiles.caption
|
|
msgctxt "TFRMMAIN.ACTSHOWSYSFILES.CAPTION"
|
|
msgid "Show &Hidden/System Files"
|
|
msgstr "Mostrar arquivos &ocultos/de sistema."
|
|
|
|
#: tfrmmain.actsortbyattr.caption
|
|
msgid "Sort by &Attributes"
|
|
msgstr "Ordenar por &atributos"
|
|
|
|
#: tfrmmain.actsortbydate.caption
|
|
msgid "Sort by &Date"
|
|
msgstr "Ordenar por &data"
|
|
|
|
#: tfrmmain.actsortbyext.caption
|
|
msgid "Sort by &Extension"
|
|
msgstr "Ordenar por &extensão"
|
|
|
|
#: tfrmmain.actsortbyname.caption
|
|
msgid "Sort by &Name"
|
|
msgstr "Ordenar por &nome"
|
|
|
|
#: tfrmmain.actsortbysize.caption
|
|
msgid "Sort by &Size"
|
|
msgstr "Ordenar por &tamanho"
|
|
|
|
#: tfrmmain.actsrcopendrives.caption
|
|
msgid "Open drive list"
|
|
msgstr "Abrir lista de drives"
|
|
|
|
#: tfrmmain.actswitchignorelist.caption
|
|
msgid "Enable/disable ignore list file to not show file names"
|
|
msgstr "Ativar/Desativar mostrar nomes de arquivos na lista de ignorados."
|
|
|
|
#: tfrmmain.actsymlink.caption
|
|
msgctxt "TFRMMAIN.ACTSYMLINK.CAPTION"
|
|
msgid "Create Symbolic &Link..."
|
|
msgstr "Criar &Link simbólico..."
|
|
|
|
#: tfrmmain.actsyncdirs.caption
|
|
msgid "Synchronize dirs..."
|
|
msgstr "Sincronizar pastas..."
|
|
|
|
#: tfrmmain.acttargetequalsource.caption
|
|
msgid "Target &= Source"
|
|
msgstr "Destino &= Origem"
|
|
|
|
#: tfrmmain.acttestarchive.caption
|
|
msgid "&Test Archive(s)"
|
|
msgstr "Arquivo(s) de &teste"
|
|
|
|
#: tfrmmain.actthumbnailsview.caption
|
|
msgctxt "tfrmmain.actthumbnailsview.caption"
|
|
msgid "Thumbnails"
|
|
msgstr "Miniaturas"
|
|
|
|
#: tfrmmain.actthumbnailsview.hint
|
|
msgid "Thumbnails View"
|
|
msgstr "Visão Miniaturas"
|
|
|
|
#: tfrmmain.acttogglefullscreenconsole.caption
|
|
msgid "Toggle fullscreen mode console"
|
|
msgstr "Alternar para modo console em tela cheia"
|
|
|
|
#: tfrmmain.acttransferleft.caption
|
|
msgid "Transfer dir under cursor to left window"
|
|
msgstr "Transferir a pasta sob o cursor para a janela esquerda."
|
|
|
|
#: tfrmmain.acttransferright.caption
|
|
msgid "Transfer dir under cursor to right window"
|
|
msgstr "Transferir a pasta sob o cursor para a janela direita."
|
|
|
|
#: tfrmmain.acttreeview.caption
|
|
msgid "&Tree View Panel"
|
|
msgstr "Painel Visão de Árvore"
|
|
|
|
#: tfrmmain.actuniversalsingledirectsort.caption
|
|
msgid "Sort according to parameters"
|
|
msgstr "Ordenar de acordo com os parâmetros"
|
|
|
|
#: tfrmmain.actunmarkcurrentextension.caption
|
|
msgid "Unselect All with the Same Ex&tension"
|
|
msgstr "Remover seleção de todos com a mesma extensão."
|
|
|
|
#: tfrmmain.actunmarkcurrentname.caption
|
|
msgid "Unselect all files with same name"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actunmarkcurrentnameext.caption
|
|
msgid "Unselect all files with same name and extension"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actunmarkcurrentpath.caption
|
|
msgid "Unselect all in same path"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actview.caption
|
|
msgctxt "tfrmmain.actview.caption"
|
|
msgid "View"
|
|
msgstr "Ver"
|
|
|
|
#: tfrmmain.actviewhistory.caption
|
|
msgid "Show history of visited paths for active view"
|
|
msgstr "Mostrar histórico de caminhos visitados na visão ativa."
|
|
|
|
#: tfrmmain.actviewhistorynext.caption
|
|
msgid "Go to next entry in history"
|
|
msgstr "Ir para a entrada seguinte no histórico."
|
|
|
|
#: tfrmmain.actviewhistoryprev.caption
|
|
msgid "Go to previous entry in history"
|
|
msgstr "Ir para a entrada anterior no histórico."
|
|
|
|
#: tfrmmain.actviewlogfile.caption
|
|
msgid "View log file"
|
|
msgstr "Ver arquivo de log"
|
|
|
|
#: tfrmmain.actviewsearches.caption
|
|
msgid "View current search instances"
|
|
msgstr ""
|
|
|
|
#: tfrmmain.actvisithomepage.caption
|
|
msgid "&Visit Double Commander Website"
|
|
msgstr "&Visitar o website do Double Commander."
|
|
|
|
#: tfrmmain.actwipe.caption
|
|
msgid "Wipe"
|
|
msgstr "Limpar"
|
|
|
|
#: tfrmmain.actworkwithdirectoryhotlist.caption
|
|
msgid "Work with Directory Hotlist and parameters"
|
|
msgstr "Trabalhar com Pasta Hotlist e parâmetros."
|
|
|
|
#: tfrmmain.btnf10.caption
|
|
msgctxt "tfrmmain.btnf10.caption"
|
|
msgid "Exit"
|
|
msgstr "Sair"
|
|
|
|
#: tfrmmain.btnf7.caption
|
|
msgctxt "tfrmmain.btnf7.caption"
|
|
msgid "Directory"
|
|
msgstr "Pasta"
|
|
|
|
#: tfrmmain.btnf8.caption
|
|
msgctxt "TFRMMAIN.BTNF8.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "Excluir"
|
|
|
|
#: tfrmmain.btnf9.caption
|
|
msgctxt "tfrmmain.btnf9.caption"
|
|
msgid "Terminal"
|
|
msgstr "Terminal"
|
|
|
|
#: tfrmmain.btnleftdirectoryhotlist.caption
|
|
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
|
|
msgid "*"
|
|
msgstr "*"
|
|
|
|
#: tfrmmain.btnleftdirectoryhotlist.hint
|
|
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.HINT"
|
|
msgid "Directory Hotlist"
|
|
msgstr "Pasta Hotlist"
|
|
|
|
#: tfrmmain.btnleftequalright.caption
|
|
msgctxt "tfrmmain.btnleftequalright.caption"
|
|
msgid "<"
|
|
msgstr "<"
|
|
|
|
#: tfrmmain.btnleftequalright.hint
|
|
msgid "Show current directory of the right panel in the left panel"
|
|
msgstr "Mostrar a pasta atual do painel direito no painel esquerdo."
|
|
|
|
#: tfrmmain.btnlefthome.caption
|
|
msgctxt "TFRMMAIN.BTNLEFTHOME.CAPTION"
|
|
msgid "~"
|
|
msgstr "~"
|
|
|
|
#: tfrmmain.btnlefthome.hint
|
|
msgctxt "TFRMMAIN.BTNLEFTHOME.HINT"
|
|
msgid "Go to home directory"
|
|
msgstr "Ir para a pasta home."
|
|
|
|
#: tfrmmain.btnleftroot.caption
|
|
msgctxt "TFRMMAIN.BTNLEFTROOT.CAPTION"
|
|
msgid "/"
|
|
msgstr "/"
|
|
|
|
#: tfrmmain.btnleftroot.hint
|
|
msgctxt "TFRMMAIN.BTNLEFTROOT.HINT"
|
|
msgid "Go to root directory"
|
|
msgstr "Ir para a pasta raíz."
|
|
|
|
#: tfrmmain.btnleftup.caption
|
|
msgctxt "TFRMMAIN.BTNLEFTUP.CAPTION"
|
|
msgid ".."
|
|
msgstr ".."
|
|
|
|
#: tfrmmain.btnleftup.hint
|
|
msgctxt "TFRMMAIN.BTNLEFTUP.HINT"
|
|
msgid "Go to parent directory"
|
|
msgstr "Ir para a pasta mãe"
|
|
|
|
#: tfrmmain.btnrightdirectoryhotlist.caption
|
|
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
|
|
msgid "*"
|
|
msgstr "*"
|
|
|
|
#: tfrmmain.btnrightdirectoryhotlist.hint
|
|
msgctxt "tfrmmain.btnrightdirectoryhotlist.hint"
|
|
msgid "Directory Hotlist"
|
|
msgstr "Pasta Hotlist"
|
|
|
|
#: tfrmmain.btnrightequalleft.caption
|
|
msgctxt "tfrmmain.btnrightequalleft.caption"
|
|
msgid ">"
|
|
msgstr ">"
|
|
|
|
#: tfrmmain.btnrightequalleft.hint
|
|
msgid "Show current directory of the left panel in the right panel"
|
|
msgstr "Mostrar a pasta atual do painel esquerdo no painel direito."
|
|
|
|
#: tfrmmain.btnrighthome.caption
|
|
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
|
|
msgid "~"
|
|
msgstr "~"
|
|
|
|
#: tfrmmain.btnrightroot.caption
|
|
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
|
|
msgid "/"
|
|
msgstr "/"
|
|
|
|
#: tfrmmain.btnrightup.caption
|
|
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
|
|
msgid ".."
|
|
msgstr ".."
|
|
|
|
#: tfrmmain.caption
|
|
msgctxt "TFRMMAIN.CAPTION"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmmain.lblcommandpath.caption
|
|
msgctxt "TFRMMAIN.LBLCOMMANDPATH.CAPTION"
|
|
msgid "Path"
|
|
msgstr "Caminho"
|
|
|
|
#: tfrmmain.mi2080.caption
|
|
msgid "&20/80"
|
|
msgstr "&20/80"
|
|
|
|
#: tfrmmain.mi3070.caption
|
|
msgid "&30/70"
|
|
msgstr "&30/70"
|
|
|
|
#: tfrmmain.mi4060.caption
|
|
msgid "&40/60"
|
|
msgstr "&40/60"
|
|
|
|
#: tfrmmain.mi5050.caption
|
|
msgid "&50/50"
|
|
msgstr "&50/50"
|
|
|
|
#: tfrmmain.mi6040.caption
|
|
msgid "&60/40"
|
|
msgstr "&60/40"
|
|
|
|
#: tfrmmain.mi7030.caption
|
|
msgid "&70/30"
|
|
msgstr "&70/30"
|
|
|
|
#: tfrmmain.mi8020.caption
|
|
msgid "&80/20"
|
|
msgstr "&80/20"
|
|
|
|
#: tfrmmain.micancel.caption
|
|
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
|
|
msgid "Cancel"
|
|
msgstr "Cancelar"
|
|
|
|
#: tfrmmain.micopy.caption
|
|
msgid "Copy..."
|
|
msgstr "Copiar..."
|
|
|
|
#: tfrmmain.mihardlink.caption
|
|
msgctxt "TFRMMAIN.MIHARDLINK.CAPTION"
|
|
msgid "Create link..."
|
|
msgstr "Criar link..."
|
|
|
|
#: tfrmmain.milogclear.caption
|
|
msgid "Clear"
|
|
msgstr "Limpar"
|
|
|
|
#: tfrmmain.milogcopy.caption
|
|
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
|
|
msgid "Copy"
|
|
msgstr "Copiar"
|
|
|
|
#: tfrmmain.miloghide.caption
|
|
msgid "Hide"
|
|
msgstr "Ocultar"
|
|
|
|
#: tfrmmain.milogselectall.caption
|
|
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
|
|
msgid "Select All"
|
|
msgstr "Selecionar tudo"
|
|
|
|
#: tfrmmain.mimove.caption
|
|
msgid "Move..."
|
|
msgstr "Mover..."
|
|
|
|
#: tfrmmain.misymlink.caption
|
|
msgctxt "TFRMMAIN.MISYMLINK.CAPTION"
|
|
msgid "Create symlink..."
|
|
msgstr "Criar ligação simbólica..."
|
|
|
|
#: tfrmmain.mitaboptions.caption
|
|
msgid "Tab options"
|
|
msgstr "Opções da Guia"
|
|
|
|
#: tfrmmain.mitrayiconexit.caption
|
|
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
|
|
msgid "E&xit"
|
|
msgstr "&Sair"
|
|
|
|
#: tfrmmain.mitrayiconrestore.caption
|
|
msgid "Restore"
|
|
msgstr "Restaurar"
|
|
|
|
#: tfrmmain.mnualloperpause.caption
|
|
msgctxt "TFRMMAIN.MNUALLOPERPAUSE.CAPTION"
|
|
msgid "||"
|
|
msgstr "||"
|
|
|
|
#: tfrmmain.mnualloperstart.caption
|
|
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
|
|
msgid "Start"
|
|
msgstr "Iniciar"
|
|
|
|
#: tfrmmain.mnualloperstop.caption
|
|
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
|
|
msgid "Cancel"
|
|
msgstr "Cancelar"
|
|
|
|
#: tfrmmain.mnucmd.caption
|
|
msgid "&Commands"
|
|
msgstr "&Comandos"
|
|
|
|
#: tfrmmain.mnuconfig.caption
|
|
msgid "C&onfiguration"
|
|
msgstr "C&onfiguração"
|
|
|
|
#: tfrmmain.mnufavoritetabs.caption
|
|
msgid "Favorites"
|
|
msgstr "Favoritos"
|
|
|
|
#: tfrmmain.mnufiles.caption
|
|
msgid "&Files"
|
|
msgstr "&Arquivos"
|
|
|
|
#: tfrmmain.mnuhelp.caption
|
|
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
|
|
msgid "&Help"
|
|
msgstr "A&juda"
|
|
|
|
#: tfrmmain.mnumark.caption
|
|
msgid "&Mark"
|
|
msgstr "&Marcar"
|
|
|
|
#: tfrmmain.mnunetwork.caption
|
|
msgctxt "TFRMMAIN.MNUNETWORK.CAPTION"
|
|
msgid "Network"
|
|
msgstr "Rede"
|
|
|
|
#: tfrmmain.mnushow.caption
|
|
msgid "&Show"
|
|
msgstr "Mos&trar"
|
|
|
|
#: tfrmmain.mnutaboptions.caption
|
|
msgctxt "TFRMMAIN.MNUTABOPTIONS.CAPTION"
|
|
msgid "Tab &Options"
|
|
msgstr "&Opções"
|
|
|
|
#: tfrmmain.mnutabs.caption
|
|
msgid "&Tabs"
|
|
msgstr "&Guias"
|
|
|
|
#: tfrmmain.tbchangedir.caption
|
|
msgid "CD"
|
|
msgstr "CD"
|
|
|
|
#: tfrmmain.tbcopy.caption
|
|
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
|
|
msgid "Copy"
|
|
msgstr "Copiar"
|
|
|
|
#: tfrmmain.tbcut.caption
|
|
msgctxt "TFRMMAIN.TBCUT.CAPTION"
|
|
msgid "Cut"
|
|
msgstr "Cortar"
|
|
|
|
#: tfrmmain.tbdelete.caption
|
|
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
|
|
msgid "Delete"
|
|
msgstr "Excluir"
|
|
|
|
#: tfrmmain.tbedit.caption
|
|
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
|
|
msgid "Edit"
|
|
msgstr "Editar"
|
|
|
|
#: tfrmmain.tbpaste.caption
|
|
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
|
|
msgid "Paste"
|
|
msgstr "Colar"
|
|
|
|
#: tfrmmaincommandsdlg.btncancel.caption
|
|
msgctxt "tfrmmaincommandsdlg.btncancel.caption"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmmaincommandsdlg.btnok.caption
|
|
msgctxt "tfrmmaincommandsdlg.btnok.caption"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmmaincommandsdlg.caption
|
|
msgid "Select your internal command"
|
|
msgstr "Selecione seu comando interno."
|
|
|
|
#: tfrmmaincommandsdlg.cbcategorysortornot.text
|
|
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
|
|
msgid "Legacy sorted"
|
|
msgstr "Legado ordenado"
|
|
|
|
#: tfrmmaincommandsdlg.cbcommandssortornot.text
|
|
msgctxt "tfrmmaincommandsdlg.cbcommandssortornot.text"
|
|
msgid "Legacy sorted"
|
|
msgstr "Legado ordenado"
|
|
|
|
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
|
|
msgid "Select all categories by default"
|
|
msgstr "Selecionar todas categorias por padrão."
|
|
|
|
#: tfrmmaincommandsdlg.gbselection.caption
|
|
msgid "Selection:"
|
|
msgstr "Seleção"
|
|
|
|
#: tfrmmaincommandsdlg.lblcategory.caption
|
|
msgid "&Categories:"
|
|
msgstr "&Categorias"
|
|
|
|
#: tfrmmaincommandsdlg.lblcommandname.caption
|
|
msgid "Command &name:"
|
|
msgstr "Nome do comando:"
|
|
|
|
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
|
|
msgid "&Filter:"
|
|
msgstr "&Filtro:"
|
|
|
|
#: tfrmmaincommandsdlg.lblhint.caption
|
|
msgid "Hint:"
|
|
msgstr "Dica"
|
|
|
|
#: tfrmmaincommandsdlg.lblhotkey.caption
|
|
msgid "Hotkey:"
|
|
msgstr "Atalho"
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommand.caption
|
|
msgid "cm_name"
|
|
msgstr "cm_name"
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
|
|
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
|
|
msgid "Category"
|
|
msgstr "Categoria"
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
|
|
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
|
|
msgid "Help"
|
|
msgstr "Ajuda"
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
|
|
msgid "Hint"
|
|
msgstr "Dicas"
|
|
|
|
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
|
|
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
|
|
msgid "Hotkey"
|
|
msgstr "Atalho"
|
|
|
|
#: tfrmmaskinputdlg.btnaddattribute.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmaskinputdlg.btnaddattribute.caption"
|
|
msgid "&Add"
|
|
msgstr "&Adicionar"
|
|
|
|
#: tfrmmaskinputdlg.btnattrshelp.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmaskinputdlg.btnattrshelp.caption"
|
|
msgid "&Help"
|
|
msgstr "A&juda"
|
|
|
|
#: tfrmmaskinputdlg.btncancel.caption
|
|
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmmaskinputdlg.btndefinetemplate.caption
|
|
msgid "&Define..."
|
|
msgstr "&Definir..."
|
|
|
|
#: tfrmmaskinputdlg.btnok.caption
|
|
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmmaskinputdlg.chkcasesensitive.caption
|
|
msgid "Case sensitive"
|
|
msgstr ""
|
|
|
|
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
|
|
msgid "Ignore accents and ligatures"
|
|
msgstr ""
|
|
|
|
#: tfrmmaskinputdlg.lblattributes.caption
|
|
msgid "Attri&butes:"
|
|
msgstr ""
|
|
|
|
#: tfrmmaskinputdlg.lblprompt.caption
|
|
msgid "Input Mask:"
|
|
msgstr ""
|
|
|
|
#: tfrmmaskinputdlg.lblsearchtemplate.caption
|
|
msgid "O&r select predefined selection type:"
|
|
msgstr "Ou seleciona&r tipo de seleção predefinido."
|
|
|
|
#: tfrmmkdir.btncancel.caption
|
|
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmmkdir.btnok.caption
|
|
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmmkdir.caption
|
|
msgid "Create new directory"
|
|
msgstr "Criar nova pasta"
|
|
|
|
#: tfrmmkdir.lblmakedir.caption
|
|
msgid "&Input new directory name:"
|
|
msgstr "&Introduza o nome da nova pasta"
|
|
|
|
#: tfrmmodview.btnpath1.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.btnpath2.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.btnpath3.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.btnpath4.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.btnpath5.caption
|
|
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmodview.caption
|
|
msgctxt "TFRMMODVIEW.CAPTION"
|
|
msgid "New Size"
|
|
msgstr "Novo tamanho"
|
|
|
|
#: tfrmmodview.lblheight.caption
|
|
msgid "Height :"
|
|
msgstr "Altura:"
|
|
|
|
#: tfrmmodview.lblpath1.caption
|
|
msgctxt "TFRMMODVIEW.LBLPATH1.CAPTION"
|
|
msgid "1"
|
|
msgstr "1"
|
|
|
|
#: tfrmmodview.lblpath2.caption
|
|
msgctxt "tfrmmodview.lblpath2.caption"
|
|
msgid "2"
|
|
msgstr "2"
|
|
|
|
#: tfrmmodview.lblpath3.caption
|
|
msgctxt "tfrmmodview.lblpath3.caption"
|
|
msgid "3"
|
|
msgstr "3"
|
|
|
|
#: tfrmmodview.lblpath4.caption
|
|
msgid "4"
|
|
msgstr "4"
|
|
|
|
#: tfrmmodview.lblpath5.caption
|
|
msgid "5"
|
|
msgstr "5"
|
|
|
|
#: tfrmmodview.lblquality.caption
|
|
msgid "Quality of compress to Jpg"
|
|
msgstr "Qualidade de compressão jpg"
|
|
|
|
#: tfrmmodview.lblwidth.caption
|
|
msgid "Width :"
|
|
msgstr "Largura:"
|
|
|
|
#: tfrmmodview.rbbmp.caption
|
|
msgid "BMP"
|
|
msgstr "BMP"
|
|
|
|
#: tfrmmodview.rbico.caption
|
|
msgid "ICO"
|
|
msgstr "ICO"
|
|
|
|
#: tfrmmodview.rbjpg.caption
|
|
msgid "JPG"
|
|
msgstr "JPG"
|
|
|
|
#: tfrmmodview.rbpng.caption
|
|
msgid "PNG"
|
|
msgstr "PNG"
|
|
|
|
#: tfrmmodview.rbpnm.caption
|
|
msgid "PNM"
|
|
msgstr "PNM"
|
|
|
|
#: tfrmmodview.teheight.text
|
|
msgctxt "tfrmmodview.teheight.text"
|
|
msgid "Height"
|
|
msgstr "Altura"
|
|
|
|
#: tfrmmodview.tequality.text
|
|
msgid "80"
|
|
msgstr "80"
|
|
|
|
#: tfrmmodview.tewidth.text
|
|
msgctxt "TFRMMODVIEW.TEWIDTH.TEXT"
|
|
msgid "Width"
|
|
msgstr "Largura"
|
|
|
|
#: tfrmmsg.lblmsg.caption
|
|
msgid "456456465465465"
|
|
msgstr ""
|
|
|
|
#: tfrmmultirename.btnclose.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Fechar"
|
|
|
|
#: tfrmmultirename.btndeletepreset.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "&Excluir"
|
|
|
|
#: tfrmmultirename.btnedit.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmultirename.btnedit.caption"
|
|
msgid "&Edit"
|
|
msgstr "&Editar"
|
|
|
|
#: tfrmmultirename.btnextmenu.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmultirename.btnloadpreset.caption
|
|
msgid "&Load"
|
|
msgstr "Ca&rregar"
|
|
|
|
#: tfrmmultirename.btnnamemenu.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmmultirename.btnrename.caption
|
|
msgctxt "tfrmmultirename.btnrename.caption"
|
|
msgid "&Rename"
|
|
msgstr "Ren&omear"
|
|
|
|
#: tfrmmultirename.btnrestore.caption
|
|
msgid "Reset &all"
|
|
msgstr "Re&por tudo"
|
|
|
|
#: tfrmmultirename.btnsavepreset.caption
|
|
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
|
|
msgid "&Save"
|
|
msgstr "&Salvar"
|
|
|
|
#: tfrmmultirename.caption
|
|
msgctxt "TFRMMULTIRENAME.CAPTION"
|
|
msgid "MultiRename"
|
|
msgstr "Multirenomear"
|
|
|
|
#: tfrmmultirename.cblog.caption
|
|
msgctxt "TFRMMULTIRENAME.CBLOG.CAPTION"
|
|
msgid "Ena&ble"
|
|
msgstr "A&tivar"
|
|
|
|
#: tfrmmultirename.cbregexp.caption
|
|
msgctxt "TFRMMULTIRENAME.CBREGEXP.CAPTION"
|
|
msgid "Regular e&xpressions"
|
|
msgstr "E&xpressões regulares"
|
|
|
|
#: tfrmmultirename.cbusesubs.caption
|
|
msgid "&Use substitution"
|
|
msgstr "&Usar substituição"
|
|
|
|
#: tfrmmultirename.cmbxwidth.text
|
|
msgid "01"
|
|
msgstr "01"
|
|
|
|
#: tfrmmultirename.edinterval.text
|
|
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
|
|
msgid "1"
|
|
msgstr "1"
|
|
|
|
#: tfrmmultirename.edpoc.text
|
|
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
|
|
msgid "1"
|
|
msgstr "1"
|
|
|
|
#: tfrmmultirename.extension.caption
|
|
msgid "[E] Extension"
|
|
msgstr "[E] Extensão"
|
|
|
|
#: tfrmmultirename.gbcounter.caption
|
|
msgid "Counter"
|
|
msgstr "Contador"
|
|
|
|
#: tfrmmultirename.gbfindreplace.caption
|
|
msgid "Find && Replace"
|
|
msgstr "Localizar && substituir"
|
|
|
|
#: tfrmmultirename.gblog.caption
|
|
msgid "Log Result"
|
|
msgstr "Log de Resultados"
|
|
|
|
#: tfrmmultirename.gbmaska.caption
|
|
msgid "Mask"
|
|
msgstr "Máscara"
|
|
|
|
#: tfrmmultirename.gbpresets.caption
|
|
msgid "Presets"
|
|
msgstr "Predefinições"
|
|
|
|
#: tfrmmultirename.lbext.caption
|
|
msgid "&Extension"
|
|
msgstr "&Extensão"
|
|
|
|
#: tfrmmultirename.lbfind.caption
|
|
msgid "&Find..."
|
|
msgstr "&Localizar"
|
|
|
|
#: tfrmmultirename.lbinterval.caption
|
|
msgid "&Interval"
|
|
msgstr "&Intervalo"
|
|
|
|
#: tfrmmultirename.lbname.caption
|
|
msgid "File &Name"
|
|
msgstr "&Nome de arquivo"
|
|
|
|
#: tfrmmultirename.lbreplace.caption
|
|
msgid "Re&place..."
|
|
msgstr "Su&bstituir"
|
|
|
|
#: tfrmmultirename.lbstnb.caption
|
|
msgid "S&tart Number"
|
|
msgstr "&Número Inicial"
|
|
|
|
#: tfrmmultirename.lbwidth.caption
|
|
msgctxt "TFRMMULTIRENAME.LBWIDTH.CAPTION"
|
|
msgid "&Width"
|
|
msgstr "&Largura"
|
|
|
|
#: tfrmmultirename.micounter.caption
|
|
msgid "[C] Counter"
|
|
msgstr "[C] Contador"
|
|
|
|
#: tfrmmultirename.miday.caption
|
|
msgid "[D] Day"
|
|
msgstr "[D] Dia"
|
|
|
|
#: tfrmmultirename.miday1.caption
|
|
msgid "[DD] Day (2 digits)"
|
|
msgstr "[DD] Dia (2 dígitos)"
|
|
|
|
#: tfrmmultirename.miday2.caption
|
|
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
|
|
msgstr "[DDD] Dia da semana (curto, ex. \"seg\")"
|
|
|
|
#: tfrmmultirename.miday3.caption
|
|
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
|
|
msgstr "[DDDD] Dia da semana (longo, ex. \"segunda\")"
|
|
|
|
#: tfrmmultirename.miextensionx.caption
|
|
msgid "[Ex] Character at position x"
|
|
msgstr "[Ex] Caracter na posição x"
|
|
|
|
#: tfrmmultirename.miextensionxx.caption
|
|
msgid "[Ex:y] Characters from position x to y"
|
|
msgstr "[Ex:y] Caracteres desde a posição x até y."
|
|
|
|
#: tfrmmultirename.mihour.caption
|
|
msgid "[h] Hour"
|
|
msgstr "[h] Hora"
|
|
|
|
#: tfrmmultirename.mihour1.caption
|
|
msgid "[hh] Hour (2 digits)"
|
|
msgstr "[hh] Hora (2 dígitos)"
|
|
|
|
#: tfrmmultirename.miminute.caption
|
|
msgid "[n] Minute"
|
|
msgstr "[n] Minuto"
|
|
|
|
#: tfrmmultirename.miminute1.caption
|
|
msgid "[nn] Minute (2 digits)"
|
|
msgstr "[nn] Minuto (2 dígitos)"
|
|
|
|
#: tfrmmultirename.mimonth.caption
|
|
msgid "[M] Month"
|
|
msgstr "[M] Mês"
|
|
|
|
#: tfrmmultirename.mimonth1.caption
|
|
msgid "[MM] Month (2 digits)"
|
|
msgstr "[MM] Mês (2 dígitos)"
|
|
|
|
#: tfrmmultirename.mimonth2.caption
|
|
msgid "[MMM] Month name (short, e.g., \"jan\")"
|
|
msgstr "[MMM] Nome do mês (curto, ex. \"jan\")"
|
|
|
|
#: tfrmmultirename.mimonth3.caption
|
|
msgid "[MMMM] Month name (long, e.g., \"january\")"
|
|
msgstr "[MMMM] Nome do mês (longo, ex. \"janeiro\")"
|
|
|
|
#: tfrmmultirename.miname.caption
|
|
msgid "[N] Name"
|
|
msgstr "[N] Nome"
|
|
|
|
#: tfrmmultirename.minamex.caption
|
|
msgid "[Nx] Character at position x"
|
|
msgstr "[Nx] Caracter na posição x"
|
|
|
|
#: tfrmmultirename.minamexx.caption
|
|
msgid "[Nx:y] Characters from position x to y"
|
|
msgstr "[Nx:y] Caracteres desde a posição x até y"
|
|
|
|
#: tfrmmultirename.minext.caption
|
|
msgid "Time..."
|
|
msgstr "Hora..."
|
|
|
|
#: tfrmmultirename.minextextension.caption
|
|
msgid "Extension..."
|
|
msgstr "Extensão..."
|
|
|
|
#: tfrmmultirename.minextname.caption
|
|
msgid "Name..."
|
|
msgstr "Nome..."
|
|
|
|
#: tfrmmultirename.miplugin.caption
|
|
msgctxt "TFRMMULTIRENAME.MIPLUGIN.CAPTION"
|
|
msgid "Plugin"
|
|
msgstr "Suplemento"
|
|
|
|
#: tfrmmultirename.misecond.caption
|
|
msgid "[s] Second"
|
|
msgstr "[s] Segundo"
|
|
|
|
#: tfrmmultirename.misecond1.caption
|
|
msgid "[ss] Second (2 digits)"
|
|
msgstr "[ss] Segundo (2 dígitos)"
|
|
|
|
#: tfrmmultirename.miyear.caption
|
|
msgid "[Y] Year (2 digits)"
|
|
msgstr "[Y] Ano (2 dígitos)"
|
|
|
|
#: tfrmmultirename.miyear1.caption
|
|
msgid "[YYYY] Year (4 digits)"
|
|
msgstr "[YYYY] Ano (4 dígitos)"
|
|
|
|
#: tfrmmultirename.mnueditnames.caption
|
|
msgid "Edit names..."
|
|
msgstr ""
|
|
|
|
#: tfrmmultirename.mnuloadfromfile.caption
|
|
msgid "Load names from file..."
|
|
msgstr ""
|
|
|
|
#: tfrmmultirename.n1.caption
|
|
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.n2.caption
|
|
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.n3.caption
|
|
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.n4.caption
|
|
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.n5.caption
|
|
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmmultirename.stringgrid.columns[0].title.caption
|
|
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[0].TITLE.CAPTION"
|
|
msgid "Old File Name"
|
|
msgstr "Nome de arquivo antigo."
|
|
|
|
#: tfrmmultirename.stringgrid.columns[1].title.caption
|
|
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[1].TITLE.CAPTION"
|
|
msgid "New File Name"
|
|
msgstr "Novo nome de arquivo."
|
|
|
|
#: tfrmmultirename.stringgrid.columns[2].title.caption
|
|
msgctxt "TFRMMULTIRENAME.STRINGGRID.COLUMNS[2].TITLE.CAPTION"
|
|
msgid "File Path"
|
|
msgstr "Caminho de arquivo"
|
|
|
|
#: tfrmmultirenamewait.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmmultirenamewait.caption"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmmultirenamewait.lblmessage.caption
|
|
msgid "Click OK when you have closed the editor to load the changed names!"
|
|
msgstr ""
|
|
|
|
#: tfrmopenwith.caption
|
|
msgid "Choose an application"
|
|
msgstr "Escolha uma aplicação."
|
|
|
|
#: tfrmopenwith.chkcustomcommand.caption
|
|
msgid "Custom command"
|
|
msgstr "Comando personlizado."
|
|
|
|
#: tfrmopenwith.chksaveassociation.caption
|
|
msgid "Save association"
|
|
msgstr "Salvar associação."
|
|
|
|
#: tfrmopenwith.chkuseasdefault.caption
|
|
msgid "Set selected application as default action"
|
|
msgstr "Definir aplicação selecionada como ação predefinida"
|
|
|
|
#: tfrmopenwith.lblmimetype.caption
|
|
msgid "File type to be opened: %s"
|
|
msgstr "Tipo de arquivo a abrir: %s"
|
|
|
|
#: tfrmopenwith.milistoffiles.caption
|
|
msgid "Multiple file names"
|
|
msgstr "Múltiplos nomes de arquivo."
|
|
|
|
#: tfrmopenwith.milistoffiles.hint
|
|
msgid "%F"
|
|
msgstr "%F"
|
|
|
|
#: tfrmopenwith.milistofurls.caption
|
|
msgid "Multiple URIs"
|
|
msgstr "Múltiplos URIs"
|
|
|
|
#: tfrmopenwith.milistofurls.hint
|
|
msgid "%U"
|
|
msgstr "%U"
|
|
|
|
#: tfrmopenwith.misinglefilename.caption
|
|
msgid "Single file name"
|
|
msgstr "Nome de arquivo único."
|
|
|
|
#: tfrmopenwith.misinglefilename.hint
|
|
msgid "%f"
|
|
msgstr "%f"
|
|
|
|
#: tfrmopenwith.misingleurl.caption
|
|
msgid "Single URI"
|
|
msgstr "URI único"
|
|
|
|
#: tfrmopenwith.misingleurl.hint
|
|
msgid "%u"
|
|
msgstr "%u"
|
|
|
|
#: tfrmoptions.btnapply.caption
|
|
msgctxt "TFRMOPTIONS.BTNAPPLY.CAPTION"
|
|
msgid "&Apply"
|
|
msgstr "&Aplicar"
|
|
|
|
#: tfrmoptions.btncancel.caption
|
|
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmoptions.btnok.caption
|
|
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmoptions.caption
|
|
msgctxt "TFRMOPTIONS.CAPTION"
|
|
msgid "Options"
|
|
msgstr "Opções"
|
|
|
|
#: tfrmoptions.lblemptyeditor.caption
|
|
msgid "Please select one of the subpages, this page does not contain any settings."
|
|
msgstr "Favor selecionar uma das subpáginas. Esta página não contém definições."
|
|
|
|
#: tfrmoptionsarchivers.btnarchiveradd.caption
|
|
msgctxt "tfrmoptionsarchivers.btnarchiveradd.caption"
|
|
msgid "A&dd"
|
|
msgstr "A&dicionar"
|
|
|
|
#: tfrmoptionsarchivers.btnarchiveraddhelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiveraddhelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverapply.caption
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverapply.caption"
|
|
msgid "A&pply"
|
|
msgstr "A&plicar"
|
|
|
|
#: tfrmoptionsarchivers.btnarchivercopy.caption
|
|
msgid "Cop&y"
|
|
msgstr "Copiar"
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverdelete.caption
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverdelete.caption"
|
|
msgid "Delete"
|
|
msgstr "Exc&luir"
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverdeletehelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverdeletehelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverextracthelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverextracthelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverextractwithoutpathhelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverlisthelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverlisthelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverother.caption
|
|
msgid "Oth&er..."
|
|
msgstr "Outro..."
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverrelativer.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverrelativer.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Algumas funções para selecionar o caminho apropriado."
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverrename.caption
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverrename.caption"
|
|
msgid "&Rename"
|
|
msgstr "&Renomear"
|
|
|
|
#: tfrmoptionsarchivers.btnarchiverselfextracthelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchiverselfextracthelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.btnarchivertesthelper.hint
|
|
msgctxt "tfrmoptionsarchivers.btnarchivertesthelper.hint"
|
|
msgid "Variable reminder helper"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.bvlarchiverids.caption
|
|
msgctxt "tfrmoptionsarchivers.bvlarchiverids.caption"
|
|
msgid "ID's used with cm_OpenArchive to recognize archive by detecting its content and not via file extension:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.bvlarchiveroptions.caption
|
|
msgctxt "tfrmoptionsarchivers.bvlarchiveroptions.caption"
|
|
msgid "Options:"
|
|
msgstr "Opções:"
|
|
|
|
#: tfrmoptionsarchivers.bvlarchiverparsingmode.caption
|
|
msgctxt "tfrmoptionsarchivers.bvlarchiverparsingmode.caption"
|
|
msgid "Format parsing mode:"
|
|
msgstr "Formatar modo de análise:"
|
|
|
|
#: tfrmoptionsarchivers.chkarchiverenabled.caption
|
|
msgctxt "tfrmoptionsarchivers.chkarchiverenabled.caption"
|
|
msgid "E&nabled"
|
|
msgstr "A&tivo"
|
|
|
|
#: tfrmoptionsarchivers.chkarchivermultiarcdebug.caption
|
|
msgid "De&bug mode"
|
|
msgstr "Modo Dep&uração"
|
|
|
|
#: tfrmoptionsarchivers.chkarchivermultiarcoutput.caption
|
|
msgctxt "tfrmoptionsarchivers.chkarchivermultiarcoutput.caption"
|
|
msgid "S&how console output"
|
|
msgstr "Mostrar saída do co&nsole."
|
|
|
|
#: tfrmoptionsarchivers.ckbarchiverunixfileattributes.caption
|
|
msgid "Uni&x file attributes"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.ckbarchiverunixpath.caption
|
|
msgid "&Unix path delimiter \"/\""
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.ckbarchiverwindowsfileattributes.caption
|
|
msgid "Windows &file attributes"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.ckbarchiverwindowspath.caption
|
|
msgid "Windows path deli&miter \"\\\""
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.lblarchiveradd.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiveradd.caption"
|
|
msgid "Add&ing:"
|
|
msgstr "A ad&icionar"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverarchiver.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverarchiver.caption"
|
|
msgid "Arc&hiver:"
|
|
msgstr "Ar&quivador:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverdelete.caption
|
|
msgid "De&lete:"
|
|
msgstr "Excluir:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverdescription.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverdescription.caption"
|
|
msgid "De&scription:"
|
|
msgstr "De&scrição:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverextension.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverextension.caption"
|
|
msgid "E&xtension:"
|
|
msgstr "E&xtensão:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverextract.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverextract.caption"
|
|
msgid "Ex&tract:"
|
|
msgstr "Ex&trair:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverextractwithoutpath.caption
|
|
msgid "Extract &without path:"
|
|
msgstr "Extrair sem caminho:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiveridposition.caption
|
|
msgid "ID Po&sition:"
|
|
msgstr "Posição da ID:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverids.caption
|
|
msgid "&ID:"
|
|
msgstr "ID:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiveridseekrange.caption
|
|
msgid "ID See&k Range:"
|
|
msgstr "Intervalo de procura de ID:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverlist.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverlist.caption"
|
|
msgid "&List:"
|
|
msgstr "&Lista:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverlistbox.caption
|
|
msgid "Archi&vers:"
|
|
msgstr "Arquivadores:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverlistend.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverlistend.caption"
|
|
msgid "Listing &finish (optional):"
|
|
msgstr "&Final da lista (opcional):"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverlistformat.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverlistformat.caption"
|
|
msgid "Listing for&mat:"
|
|
msgstr "For&mato da lista:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverliststart.caption
|
|
msgctxt "tfrmoptionsarchivers.lblarchiverliststart.caption"
|
|
msgid "Listin&g start (optional):"
|
|
msgstr "Iní&cio da lista (opcional):"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverpasswordquery.caption
|
|
msgid "Password &query string:"
|
|
msgstr "Cadeia de consulta da palavra passe:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchiverselfextract.caption
|
|
msgid "Create self extractin&g archive:"
|
|
msgstr "Criar arquivo de extração automática:"
|
|
|
|
#: tfrmoptionsarchivers.lblarchivertest.caption
|
|
msgid "Tes&t:"
|
|
msgstr "Teste:"
|
|
|
|
#: tfrmoptionsarchivers.miarchiverautoconfigure.caption
|
|
msgid "Auto Configure"
|
|
msgstr "Autoconfigurar"
|
|
|
|
#: tfrmoptionsarchivers.miarchiverdisableall.caption
|
|
msgid "Disable all"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.miarchiverdiscardmodification.caption
|
|
msgid "Discard modifications"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.miarchiverenableall.caption
|
|
msgid "Enable all"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.miarchiverexport.caption
|
|
msgctxt "tfrmoptionsarchivers.miarchiverexport.caption"
|
|
msgid "Export..."
|
|
msgstr "Exportar..."
|
|
|
|
#: tfrmoptionsarchivers.miarchiverimport.caption
|
|
msgctxt "tfrmoptionsarchivers.miarchiverimport.caption"
|
|
msgid "Import..."
|
|
msgstr "Importar..."
|
|
|
|
#: tfrmoptionsarchivers.miarchiversortarchivers.caption
|
|
msgid "Sort archivers"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsarchivers.tbarchiveradditional.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERADDITIONAL.CAPTION"
|
|
msgid "Additional"
|
|
msgstr "Adicional"
|
|
|
|
#: tfrmoptionsarchivers.tbarchivergeneral.caption
|
|
msgctxt "TFRMOPTIONSARCHIVERS.TBARCHIVERGENERAL.CAPTION"
|
|
msgid "General"
|
|
msgstr "Geral"
|
|
|
|
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHATTRIBUTESCHANGE.CAPTION"
|
|
msgid "When &size, date or attributes change"
|
|
msgstr "Quando tamanho, data ou atributo&s mudam."
|
|
|
|
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHEXCLUDEDIRS.CAPTION"
|
|
msgid "For the following &paths and their subdirectories:"
|
|
msgstr "Para os seguintes caminhos e suas sub&pastas:"
|
|
|
|
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHFILENAMECHANGE.CAPTION"
|
|
msgid "When &files are created, deleted or renamed"
|
|
msgstr "Quando &arquivos são criados, apagados ou renomeados."
|
|
|
|
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.CBWATCHONLYFOREGROUND.CAPTION"
|
|
msgid "When application is in the &background"
|
|
msgstr "Quando a aplicação está em 2º &plano."
|
|
|
|
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHDISABLE.CAPTION"
|
|
msgid "Disable auto-refresh"
|
|
msgstr "Desativar atualização automática"
|
|
|
|
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
|
|
msgctxt "TFRMOPTIONSAUTOREFRESH.GBAUTOREFRESHENABLE.CAPTION"
|
|
msgid "Refresh file list"
|
|
msgstr "Atualizar lista de arquivos."
|
|
|
|
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
|
|
msgctxt "TFRMOPTIONSBEHAVIOR.CBALWAYSSHOWTRAYICON.CAPTION"
|
|
msgid "Al&ways show tray icon"
|
|
msgstr "Mos&trar sempre ícone no tabuleiro."
|
|
|
|
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
|
|
msgid "Automatically &hide unmounted devices"
|
|
msgstr "&Ocultar automaticamente os dispositivos não montados."
|
|
|
|
#: tfrmoptionsbehavior.cbminimizetotray.caption
|
|
msgctxt "TFRMOPTIONSBEHAVIOR.CBMINIMIZETOTRAY.CAPTION"
|
|
msgid "Mo&ve icon to system tray when minimized"
|
|
msgstr "Mo&ver ícone para o tabuleiro de sistema ao minimizar."
|
|
|
|
#: tfrmoptionsbehavior.cbonlyonce.caption
|
|
msgctxt "TFRMOPTIONSBEHAVIOR.CBONLYONCE.CAPTION"
|
|
msgid "A&llow only one copy of DC at a time"
|
|
msgstr "Permitir só uma instância do DC de cada vez."
|
|
|
|
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
|
|
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
|
|
msgstr "Aqui você pode digitar um ou mais dispositivos ou pontos de montagem, separados por \";\"."
|
|
|
|
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
|
|
msgid "Drives &blacklist"
|
|
msgstr "Lista &negra de drives:"
|
|
|
|
#: tfrmoptionsbriefview.gbcolumns.caption
|
|
msgid "Columns size"
|
|
msgstr "Tamanho das colunas."
|
|
|
|
#: tfrmoptionsbriefview.gbshowfileext.caption
|
|
msgid "Show file extensions"
|
|
msgstr "Mostrar extensões dos arquivos."
|
|
|
|
#: tfrmoptionsbriefview.rbaligned.caption
|
|
msgid "ali&gned (with Tab)"
|
|
msgstr "alin&hado (com Tab)."
|
|
|
|
#: tfrmoptionsbriefview.rbdirectly.caption
|
|
msgid "di&rectly after filename"
|
|
msgstr "di&retamente após nome do arquivo."
|
|
|
|
#: tfrmoptionsbriefview.rbuseautosize.caption
|
|
msgid "Auto"
|
|
msgstr "Auto"
|
|
|
|
#: tfrmoptionsbriefview.rbusefixedcount.caption
|
|
msgid "Fixed columns count"
|
|
msgstr "Contagem de colunas fixas:"
|
|
|
|
#: tfrmoptionsbriefview.rbusefixedwidth.caption
|
|
msgid "Fixed columns width"
|
|
msgstr "Largura de colunas fixas:"
|
|
|
|
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
|
|
msgid "Cut &text to column width"
|
|
msgstr "Cortar &texto pela largura da coluna."
|
|
|
|
#: tfrmoptionscolumnsview.cbextendcellwidth.caption
|
|
msgid "&Extend cell width if text is not fitting into column"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionscolumnsview.cbgridhorzline.caption
|
|
msgid "&Horizontal lines"
|
|
msgstr "Linhas &horizontais"
|
|
|
|
#: tfrmoptionscolumnsview.cbgridvertline.caption
|
|
msgid "&Vertical lines"
|
|
msgstr "Linhas &verticais."
|
|
|
|
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
|
|
msgid "A&uto fill columns"
|
|
msgstr "Preencher automaticamente colunas."
|
|
|
|
#: tfrmoptionscolumnsview.gbshowgrid.caption
|
|
msgid "Show grid"
|
|
msgstr "Mostrar grade."
|
|
|
|
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
|
|
msgid "Auto-size columns"
|
|
msgstr "Tamanho de coluna automático."
|
|
|
|
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
|
|
msgid "Auto si&ze column:"
|
|
msgstr "Tamanho de c&oluna automático:"
|
|
|
|
#: tfrmoptionsconfiguration.btnconfigapply.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
|
|
msgid "A&pply"
|
|
msgstr "A&plicar"
|
|
|
|
#: tfrmoptionsconfiguration.btnconfigedit.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "&Editar"
|
|
|
|
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
|
|
msgid "Co&mmand line history"
|
|
msgstr "Histórico da linha de co&mandos."
|
|
|
|
#: tfrmoptionsconfiguration.cbdirhistory.caption
|
|
msgctxt "TFRMOPTIONSCONFIGURATION.CBDIRHISTORY.CAPTION"
|
|
msgid "&Directory history"
|
|
msgstr "Histórico de &pastas."
|
|
|
|
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
|
|
msgid "&File mask history"
|
|
msgstr "Histórico de máscaras de &arquivos."
|
|
|
|
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
|
|
msgid "Sa&ve configuration"
|
|
msgstr "Gra&var configuração."
|
|
|
|
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
|
|
msgid "Searc&h/Replace history"
|
|
msgstr "Histórico de Locali&zar/Substituir."
|
|
|
|
#: tfrmoptionsconfiguration.gbdirectories.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsconfiguration.gbdirectories.caption"
|
|
msgid "Directories"
|
|
msgstr "Pastas"
|
|
|
|
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
|
|
msgid "Location of configuration files"
|
|
msgstr "Localização dos arquivos de configuração."
|
|
|
|
#: tfrmoptionsconfiguration.gbsaveonexit.caption
|
|
msgid "Save on exit"
|
|
msgstr "Salvar ao sair."
|
|
|
|
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
|
|
msgid "Sort order of configuration order in left tree"
|
|
msgstr "Ordem de classificação da ordem de configuração no painel esquerdo."
|
|
|
|
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
|
|
msgid "Set on command line"
|
|
msgstr "Definir na linha de comandos"
|
|
|
|
#: tfrmoptionsconfiguration.lblhighlighters.caption
|
|
msgid "Highlighters:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsconfiguration.lbliconthemes.caption
|
|
msgid "Icon themes:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsconfiguration.lblthumbcache.caption
|
|
msgid "Thumbnails cache:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsconfiguration.rbprogramdir.caption
|
|
msgid "P&rogram directory (portable version)"
|
|
msgstr "Pasta do p&rograma (versão portátil)."
|
|
|
|
#: tfrmoptionsconfiguration.rbuserhomedir.caption
|
|
msgid "&User home directory"
|
|
msgstr "Pasta home do &usuário"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.caption"
|
|
msgid "All"
|
|
msgstr "Todos"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallallowovercolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Aplicar modificações para todas colunas"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.caption"
|
|
msgid "All"
|
|
msgstr "Todos"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Aplicar modificações para todas colunas."
|
|
|
|
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.caption"
|
|
msgid "All"
|
|
msgstr "Todos"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallbackcolor2.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Aplicar modificações para todas colunas"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.caption"
|
|
msgid "All"
|
|
msgstr "Todos"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallcursorcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Aplicar modificações para todas colunas."
|
|
|
|
#: tfrmoptionscustomcolumns.btnallcursortext.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.caption"
|
|
msgid "All"
|
|
msgstr "Todos"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallcursortext.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallcursortext.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Aplicar modificações para todas colunas."
|
|
|
|
#: tfrmoptionscustomcolumns.btnallfont.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
|
|
msgid "All"
|
|
msgstr "Todos"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallfont.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Aplicar modificações para todas colunas."
|
|
|
|
#: tfrmoptionscustomcolumns.btnallforecolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.caption"
|
|
msgid "All"
|
|
msgstr "Todos"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallforecolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallforecolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Aplicar modificações para todas colunas"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption"
|
|
msgid "All"
|
|
msgstr "Todos"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Aplicar modificações para todas colunas"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption"
|
|
msgid "All"
|
|
msgstr "Todos"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Aplicar modificações para todas colunas"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.caption"
|
|
msgid "All"
|
|
msgstr "Todos"
|
|
|
|
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnallmarkcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Aplicar modificações para todas colunas"
|
|
|
|
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption"
|
|
msgid "All"
|
|
msgstr "Todos"
|
|
|
|
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Aplicar modificações para todas colunas"
|
|
|
|
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.caption"
|
|
msgid "All"
|
|
msgstr "Todos"
|
|
|
|
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnalluseinvertedselection.hint"
|
|
msgid "Apply modification to all columns"
|
|
msgstr "Aplicar modificações para todas colunas."
|
|
|
|
#: tfrmoptionscustomcolumns.btnbackcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnbackcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnbackcolor2.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btncursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btncursorcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btncursortext.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btncursortext.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption"
|
|
msgid "&Delete"
|
|
msgstr "&Excluir"
|
|
|
|
#: tfrmoptionscustomcolumns.btnfont.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnfont.caption"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionscustomcolumns.btnforecolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnforecolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
|
|
msgid "Go to set default"
|
|
msgstr "Ir para definição padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btngotosetdefault.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btninactivecursorcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btninactivemarkcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnmarkcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionscustomcolumns.btnnewconfig.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnnewconfig.caption"
|
|
msgid "New"
|
|
msgstr "Novo"
|
|
|
|
#: tfrmoptionscustomcolumns.btnnext.caption
|
|
msgid "Next"
|
|
msgstr "Próximo"
|
|
|
|
#: tfrmoptionscustomcolumns.btnprev.caption
|
|
msgid "Previous"
|
|
msgstr "Anterior"
|
|
|
|
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption"
|
|
msgid "Rename"
|
|
msgstr "Renomear"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetallowovercolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetbackcolor2.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursorcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetcursortext.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetfont.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetfont.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetfont.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetfont.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetforecolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetframecursor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetmarkcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption"
|
|
msgid "R"
|
|
msgstr "R"
|
|
|
|
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
|
|
msgctxt "tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint"
|
|
msgid "Reset to default"
|
|
msgstr "Redefinir para padrão."
|
|
|
|
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption"
|
|
msgid "Save as"
|
|
msgstr "Salvar como"
|
|
|
|
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
|
|
msgctxt "tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption"
|
|
msgid "Save"
|
|
msgstr "Salvar"
|
|
|
|
#: tfrmoptionscustomcolumns.cballowovercolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
|
|
msgid "Allow Overcolor"
|
|
msgstr "Permitir cor sobreposta."
|
|
|
|
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
|
|
msgid "When clicking to change something, change for all columns"
|
|
msgstr "Ao clicar para alterar algo, altere para todas as colunas."
|
|
|
|
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
|
|
msgctxt "tfrmoptionscustomcolumns.cbconfigcolumns.text"
|
|
msgid "General"
|
|
msgstr "Geral"
|
|
|
|
#: tfrmoptionscustomcolumns.cbcursorborder.caption
|
|
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
|
|
msgid "Cursor border"
|
|
msgstr "Contorno do cursor"
|
|
|
|
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
|
|
msgid "Use Frame Cursor"
|
|
msgstr "Usar Moldura Cursor."
|
|
|
|
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
|
|
msgid "Use Inactive Selection Color"
|
|
msgstr "Usar Seleção de Cor Inativa."
|
|
|
|
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
|
|
msgid "Use Inverted Selection"
|
|
msgstr "Usar Seleção Invertida."
|
|
|
|
#: tfrmoptionscustomcolumns.chkusecustomview.caption
|
|
msgid "Use custom font and color for this view"
|
|
msgstr "Usar fonte e cor customizada para esta visão."
|
|
|
|
#: tfrmoptionscustomcolumns.lblbackcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblbackcolor.caption"
|
|
msgid "BackGround:"
|
|
msgstr "Fundo:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblbackcolor2.caption"
|
|
msgid "Background 2:"
|
|
msgstr "Fundo 2:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
|
|
msgid "Con&figure columns view:"
|
|
msgstr "Con&figurar visão colunas:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
|
|
msgid "[Current Column Name]"
|
|
msgstr "[Nome da Coluna Atual]"
|
|
|
|
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblcursorcolor.caption"
|
|
msgid "Cursor Color:"
|
|
msgstr "Cor do cursor:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblcursortext.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblcursortext.caption"
|
|
msgid "Cursor Text:"
|
|
msgstr "Texto do cursor:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblfontname.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblfontname.caption"
|
|
msgid "Font:"
|
|
msgstr "Fonte:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblfontsize.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblfontsize.caption"
|
|
msgid "Size:"
|
|
msgstr "Tamanho:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblforecolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblforecolor.caption"
|
|
msgid "Text Color:"
|
|
msgstr "Cor do texto:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
|
|
msgid "Inactive Cursor Color:"
|
|
msgstr "Cor do Cursor Inativa:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
|
|
msgid "Inactive Mark Color:"
|
|
msgstr "Cor da Marca Inativa:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblmarkcolor.caption"
|
|
msgid "Mark Color:"
|
|
msgstr "Cor de marca:"
|
|
|
|
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
|
|
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
|
|
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
|
msgstr "Abaixo está uma pré-visualização. Você pode mover o cursor e selecionar arquivos para obter imediatamente uma aparência real das várias configurações."
|
|
|
|
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
|
|
msgid "Settings for column:"
|
|
msgstr "Definições para coluna."
|
|
|
|
#: tfrmoptionscustomcolumns.miaddcolumn.caption
|
|
msgctxt "tfrmoptionscustomcolumns.miaddcolumn.caption"
|
|
msgid "Add column"
|
|
msgstr "Adicionar coluna."
|
|
|
|
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
|
|
msgid "Position of frame panel after the comparison:"
|
|
msgstr "Posição do painel do quadro após a comparação:"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddactiveframedir.caption
|
|
msgid "Add directory of the &active frame"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddbothframedir.caption
|
|
msgid "Add &directories of the active && inactive frames"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddbrowseddir.caption
|
|
msgid "Add directory I will bro&wse to"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actaddcopyofentry.caption"
|
|
msgid "Add a copy of the selected entry"
|
|
msgstr "Adicionar uma cópia da entrada selecionada"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddselectionsfromframe.caption
|
|
msgid "Add current &selected or active directories of active frame"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddseparator.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actaddseparator.caption"
|
|
msgid "Add a separator"
|
|
msgstr "Adicionar um guia"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddsubmenu.caption
|
|
msgid "Add a sub menu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actaddtypeddir.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actaddtypeddir.caption"
|
|
msgid "Add directory I will type"
|
|
msgstr "Adicionar pasta. Eu irei digitar"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actcollapseall.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actcollapseall.caption"
|
|
msgid "Collapse all"
|
|
msgstr "Expandir tudo"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actcollapseitem.caption
|
|
msgid "Collapse item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actcut.caption
|
|
msgid "Cut selection of entries"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actdeleteall.caption
|
|
msgid "Delete all!"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actdeleteselecteditem.caption"
|
|
msgid "Delete selected item"
|
|
msgstr "Excluir item selecionado"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actdeletesubmenuandelem.caption
|
|
msgid "Delete sub-menu and all its elements"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actdeletesubmenukeepelem.caption
|
|
msgid "Delete just sub-menu but keep elements"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actexpanditem.caption
|
|
msgid "Expand item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actfocustreewindow.caption
|
|
msgid "Focus tree window"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actgotofirstitem.caption
|
|
msgid "Goto first item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actgotolastitem.caption
|
|
msgid "Goto last item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actgotonextitem.caption
|
|
msgid "Go to next item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actgotopreviousitem.caption
|
|
msgid "Go to previous item"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertactiveframedir.caption
|
|
msgid "Insert directory of the &active frame"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertbothframedir.caption
|
|
msgid "Insert &directories of the active && inactive frames"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertbrowseddir.caption
|
|
msgid "Insert directory I will bro&wse to"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertcopyofentry.caption
|
|
msgid "Insert a copy of the selected entry"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertselectionsfromframe.caption
|
|
msgid "Insert current &selected or active directories of active frame"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertseparator.caption
|
|
msgid "Insert a separator"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinsertsubmenu.caption
|
|
msgid "Insert sub menu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actinserttypeddir.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actinserttypeddir.caption"
|
|
msgid "Insert directory I will type"
|
|
msgstr "Inserir pasta. Eu irei digitar"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actmovetonext.caption
|
|
msgid "Move to next"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actmovetoprevious.caption
|
|
msgid "Move to previous"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actopenallbranches.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsdirectoryhotlist.actopenallbranches.caption"
|
|
msgid "Open all branches"
|
|
msgstr "Abrir todos os ramos"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actpaste.caption
|
|
msgid "Paste what was cut"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpath.caption
|
|
msgid "Search && replace in &path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceinpathandtarget.caption
|
|
msgid "Search && replace in both path and target"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.actsearchandreplaceintargetpath.caption
|
|
msgid "Search && replace in &target path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.acttweakpath.caption
|
|
msgid "Tweak path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.acttweaktargetpath.caption
|
|
msgid "Tweak target path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnadd.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
|
|
msgid "A&dd..."
|
|
msgstr "Adicionar..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
|
|
msgid "Bac&kup..."
|
|
msgstr "Backup..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btndelete.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
|
|
msgid "De&lete..."
|
|
msgstr "Excluir..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnexport.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
|
|
msgid "E&xport..."
|
|
msgstr "Exportar..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnhelp.caption"
|
|
msgid "&Help"
|
|
msgstr "Ajuda"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnimport.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
|
|
msgid "Impo&rt..."
|
|
msgstr "Importar..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btninsert.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
|
|
msgid "&Insert..."
|
|
msgstr "Inserir..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
|
|
msgid "&Miscellaneous..."
|
|
msgstr "Miscelâneo..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativepath.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Algumas funções para selecionar o caminho apropriado"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnrelativetarget.hint"
|
|
msgid "Some functions to select appropriate target"
|
|
msgstr "Algumas funções para selecionar o destino apropriado."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.btnsort.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
|
|
msgid "&Sort..."
|
|
msgstr "Ordenar..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
|
|
msgid "&When adding directory, add also target"
|
|
msgstr "Ao adicionar pasta, adicionar também destino."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
|
|
msgid "Alwa&ys expand tree"
|
|
msgstr "Sempre expandir a árvore."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
|
|
msgid "Show only &valid environment variables"
|
|
msgstr "Mostrar somente variáveis de ambiente válidas."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
|
|
msgid "In pop&up, show [path also]"
|
|
msgstr "No popup, mostrar [caminho também]."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
|
|
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
|
|
msgid "Name, a-z"
|
|
msgstr "Nome, a-z"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
|
|
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text"
|
|
msgid "Name, a-z"
|
|
msgstr "Nome, a-z"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
|
|
msgid "Directory Hotlist (reorder by drag && drop)"
|
|
msgstr "Pasta Hotlist (reordenar por arrastar e soltar)."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
|
|
msgid "Other options"
|
|
msgstr "Outras opções"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption"
|
|
msgid "Name:"
|
|
msgstr "Nome:"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption"
|
|
msgid "Path:"
|
|
msgstr "Caminho:"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption"
|
|
msgid "&Target:"
|
|
msgstr "Destino:"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
|
|
msgid "...current le&vel of item(s) selected only"
|
|
msgstr "...nível atual somente dos itens selecionados."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathexist.caption"
|
|
msgid "Scan all &hotdir's path to validate the ones that actually exist"
|
|
msgstr "Verificar o caminho de todos os hotdir para validar os que realmente existem."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption"
|
|
msgid "&Scan all hotdir's path && target to validate the ones that actually exist"
|
|
msgstr "Analisar todo o caminho do hotdir e destino para validar os que realmente existem."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
|
|
msgid "to a Directory &Hotlist file (.hotlist)"
|
|
msgstr "Para um arquivo da pasta Hotlist (.hotlist)."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (&keep existing)"
|
|
msgstr "para um \"wincmd.ini\" do TC (manter o existente)."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (&erase existing)"
|
|
msgstr "para um \"wincmd.ini\" do TC (excluir o existente)"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
|
|
msgid "Go to &configure TC related info"
|
|
msgstr "Vá para configurar as informações relacionadas ao TC."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption"
|
|
msgid "Go to &configure TC related info"
|
|
msgstr "Vá para configurar as informações relacionadas ao TC."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
|
|
msgid "HotDirTestMenu"
|
|
msgstr "HotDirTestMenu"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
|
|
msgid "from a Directory &Hotlist file (.hotlist)"
|
|
msgstr "de um arquivo da pasta Hotlist (.hotlist)"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
|
|
msgid "from \"&wincmd.ini\" of TC"
|
|
msgstr "do \"wincmd.ini\" do TC."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.minavigate.caption
|
|
msgid "&Navigate..."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
|
|
msgid "&Restore a backup of Directory Hotlist"
|
|
msgstr "Restaurar um backup da pasta Hotlist."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
|
|
msgid "&Save a backup of current Directory Hotlist"
|
|
msgstr "Salvar um backup da atual pasta Hotlist."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
|
|
msgid "Search and &replace..."
|
|
msgstr "Pesquisar e trocar..."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
|
|
msgid "...everything, from A to &Z!"
|
|
msgstr "...tudo, de A a Z!"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
|
|
msgid "...single &group of item(s) only"
|
|
msgstr "...um único grupo de item (s)."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
|
|
msgid "...&content of submenu(s) selected, no sublevel"
|
|
msgstr "...conteúdo do submenu(s) selecionado e nenhum subnível."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
|
|
msgid "...content of submenu(s) selected and &all sublevels"
|
|
msgstr "...conteúdo do submenu(s) selecionado e todos subníveis."
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
|
|
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
|
|
msgid "Test resultin&g menu"
|
|
msgstr "Teste o menu resultante"
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mitweakpath.caption
|
|
msgid "Tweak &path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.mitweaktargetpath.caption
|
|
msgid "Tweak &target path"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
|
|
msgid "Addition from main panel"
|
|
msgstr "Adição do painel principal"
|
|
|
|
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
|
|
msgid "From all the supported formats, ask which one to use every time"
|
|
msgstr "De todos os formatos suortado. Perguntar qual usar sempre."
|
|
|
|
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
|
|
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
|
|
msgstr "Ao salvar texto Unicode, salvá-lo no formato UTF8 (será UTF16 caso contrário)."
|
|
|
|
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
|
|
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
|
|
msgstr "Ao largar o texto, gere o nome do arquivo automaticamente (caso contrário, o usuário será alertado)."
|
|
|
|
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
|
|
msgid "&Show confirmation dialog after drop"
|
|
msgstr "Mo&strar diálogo de confirmação após largar."
|
|
|
|
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
|
|
msgid "When drag && dropping text into panels:"
|
|
msgstr "Quando arrastar e soltar texto nos painéis:"
|
|
|
|
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
|
|
msgid "Place the most desired format on top of list (use dag && drop):"
|
|
msgstr "Coloque o formato mais desejado no topo da lista (use arrastar e soltar)."
|
|
|
|
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
|
|
msgid "(if the most desired is not present, we'll take second one and so on)"
|
|
msgstr "(Se o mais desejado não estiver presente, tomaremos o segundo e assim por diante)."
|
|
|
|
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
|
|
msgid "(will not work with some source application, so try to uncheck if problem)"
|
|
msgstr "(Não funcionará com algum aplicativo de origem, então tente desmarcar se problema)."
|
|
|
|
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
|
|
msgid "Show &file system"
|
|
msgstr "Mostrar sistema de &arquivos."
|
|
|
|
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
|
|
msgid "Show fr&ee space"
|
|
msgstr "Mostrar &espaço livre."
|
|
|
|
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
|
|
msgid "Show &label"
|
|
msgstr "Mostrar rótu&lo."
|
|
|
|
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
|
|
msgid "Drives list"
|
|
msgstr "Lista de unidades."
|
|
|
|
#: tfrmoptionseditor.chkautoindent.caption
|
|
msgid "Auto Indent"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chkautoindent.hint
|
|
msgid "Allows to indent the caret, when new line is created with <Enter>, with the same amount of leading white space as the preceding line"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chkscrollpastendline.caption
|
|
msgid "Caret past end of line"
|
|
msgstr "Caret passado final da linha."
|
|
|
|
#: tfrmoptionseditor.chkscrollpastendline.hint
|
|
msgid "Allows caret to go into empty space beyond end-of-line position"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chkshowspecialchars.caption
|
|
msgid "Show special characters"
|
|
msgstr "Mostrar caracteres epeciais."
|
|
|
|
#: tfrmoptionseditor.chkshowspecialchars.hint
|
|
msgid "Shows special characters for spaces and tabulations"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chktabindent.caption
|
|
msgid "Tab indents blocks"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chktabindent.hint
|
|
msgid "When active <Tab> and <Shift+Tab> act as block indent, unindent when text is selected"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chktabstospaces.caption
|
|
msgid "Use spaces instead tab characters"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chktabstospaces.hint
|
|
msgid "Converts tab characters to a specified number of space characters (when entering)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chktrimtrailingspaces.caption
|
|
msgid "Delete trailing spaces"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.chktrimtrailingspaces.hint
|
|
msgid "Auto delete trailing spaces, this applies only to edited lines"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionseditor.gbinternaleditor.caption
|
|
msgid "Internal editor options"
|
|
msgstr "Opções do editor interno."
|
|
|
|
#: tfrmoptionseditorcolors.backgroundlabel.caption
|
|
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
|
|
msgid "Bac&kground"
|
|
msgstr "F&undo"
|
|
|
|
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
|
|
msgid "Bac&kground"
|
|
msgstr "F&undo"
|
|
|
|
#: tfrmoptionseditorcolors.btnresetmask.hint
|
|
msgid "Reset"
|
|
msgstr "Reiniciar"
|
|
|
|
#: tfrmoptionseditorcolors.btnsavemask.hint
|
|
msgctxt "tfrmoptionseditorcolors.btnsavemask.hint"
|
|
msgid "Save"
|
|
msgstr "Salvar"
|
|
|
|
#: tfrmoptionseditorcolors.bvlattributesection.caption
|
|
msgid "Element Attributes"
|
|
msgstr "Atributos de elemento"
|
|
|
|
#: tfrmoptionseditorcolors.foregroundlabel.caption
|
|
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
|
|
msgid "Fo®round"
|
|
msgstr "1º p&lano"
|
|
|
|
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
|
|
msgid "Fo®round"
|
|
msgstr "1º p&lano"
|
|
|
|
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
|
|
msgid "&Text-mark"
|
|
msgstr "Marca de &texto"
|
|
|
|
#: tfrmoptionseditorcolors.tbtnglobal.caption
|
|
msgid "Use (and edit) &global scheme settings"
|
|
msgstr "Usar (e editar) definições de esquema &globais."
|
|
|
|
#: tfrmoptionseditorcolors.tbtnlocal.caption
|
|
msgid "Use &local scheme settings"
|
|
msgstr "Usar definições de esquema &locais"
|
|
|
|
#: tfrmoptionseditorcolors.textboldcheckbox.caption
|
|
msgid "&Bold"
|
|
msgstr "&Negrito"
|
|
|
|
#: tfrmoptionseditorcolors.textboldradioinvert.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
|
|
msgid "In&vert"
|
|
msgstr "In&verter"
|
|
|
|
#: tfrmoptionseditorcolors.textboldradiooff.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
|
|
msgid "O&ff"
|
|
msgstr "Desl&igar"
|
|
|
|
#: tfrmoptionseditorcolors.textboldradioon.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
|
|
msgid "O&n"
|
|
msgstr "Li&gar"
|
|
|
|
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
|
|
msgid "&Italic"
|
|
msgstr "&Itálico"
|
|
|
|
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
|
|
msgid "In&vert"
|
|
msgstr "In&verter"
|
|
|
|
#: tfrmoptionseditorcolors.textitalicradiooff.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
|
|
msgid "O&ff"
|
|
msgstr "Desl&igar"
|
|
|
|
#: tfrmoptionseditorcolors.textitalicradioon.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
|
|
msgid "O&n"
|
|
msgstr "Li&gar"
|
|
|
|
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
|
|
msgid "&Strike Out"
|
|
msgstr "&Rasurado"
|
|
|
|
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
|
|
msgid "In&vert"
|
|
msgstr "In&verter"
|
|
|
|
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
|
|
msgid "O&ff"
|
|
msgstr "Desl&igar"
|
|
|
|
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
|
|
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
|
|
msgid "O&n"
|
|
msgstr "Li&gar"
|
|
|
|
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
|
|
msgid "&Underline"
|
|
msgstr "&Sublinhado"
|
|
|
|
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
|
|
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
|
|
msgid "In&vert"
|
|
msgstr "In&verter"
|
|
|
|
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
|
|
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
|
|
msgid "O&ff"
|
|
msgstr "Desl&igar"
|
|
|
|
#: tfrmoptionseditorcolors.textunderlineradioon.caption
|
|
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
|
|
msgid "O&n"
|
|
msgstr "Li&gar"
|
|
|
|
#: tfrmoptionsfavoritetabs.btnadd.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.btnadd.caption"
|
|
msgid "Add..."
|
|
msgstr "Adicionar..."
|
|
|
|
#: tfrmoptionsfavoritetabs.btndelete.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.btndelete.caption"
|
|
msgid "Delete..."
|
|
msgstr "Excluir..."
|
|
|
|
#: tfrmoptionsfavoritetabs.btnimportexport.caption
|
|
msgid "Import/Export"
|
|
msgstr "Importar/Exportar"
|
|
|
|
#: tfrmoptionsfavoritetabs.btninsert.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.btninsert.caption"
|
|
msgid "Insert..."
|
|
msgstr "Inserir..."
|
|
|
|
#: tfrmoptionsfavoritetabs.btnrename.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.btnrename.caption"
|
|
msgid "Rename"
|
|
msgstr "Renomear"
|
|
|
|
#: tfrmoptionsfavoritetabs.btnsort.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.btnsort.caption"
|
|
msgid "Sort..."
|
|
msgstr "Ordenar..."
|
|
|
|
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
|
|
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
|
|
msgid "None"
|
|
msgstr "Nenhum"
|
|
|
|
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.cbfullexpandtree.caption"
|
|
msgid "Always expand tree"
|
|
msgstr "Sempre expandir árvore"
|
|
|
|
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
|
|
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
|
|
msgid "No"
|
|
msgstr "Não"
|
|
|
|
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
|
|
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
|
|
msgid "Left"
|
|
msgstr "Esquerda"
|
|
|
|
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
|
|
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
|
|
msgid "Right"
|
|
msgstr "Direita"
|
|
|
|
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
|
|
msgid "Favorite Tabs list (reorder by drag && drop)"
|
|
msgstr "Lista de Guias Favoritas (reordenar por arrastar e soltar)."
|
|
|
|
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption"
|
|
msgid "Other options"
|
|
msgstr "Outras opções"
|
|
|
|
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
|
|
msgid "What to restore where for the selected entry:"
|
|
msgstr "O que restaurar e onde para a entrada selecionada:"
|
|
|
|
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
|
|
msgid "Existing tabs to keep:"
|
|
msgstr "Manter guias existentes:"
|
|
|
|
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
|
|
msgid "Save dir history:"
|
|
msgstr "Salvar histórico de pastas:"
|
|
|
|
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
|
|
msgid "Tabs saved on left to be restored to:"
|
|
msgstr "Abas salvas na esquerda são para serem restauradas em:"
|
|
|
|
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
|
|
msgid "Tabs saved on right to be restored to:"
|
|
msgstr "Abas salvas na direita são para serem restauradas em:"
|
|
|
|
#: tfrmoptionsfavoritetabs.menuitem1.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.menuitem1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.menuitem2.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.menuitem2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miaddseparator.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miaddseparator.caption"
|
|
msgid "a separator"
|
|
msgstr "um guia"
|
|
|
|
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
|
|
msgid "Add separator"
|
|
msgstr "Adicionar guia"
|
|
|
|
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu.caption"
|
|
msgid "sub-menu"
|
|
msgstr "sub-menu"
|
|
|
|
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miaddsubmenu2.caption"
|
|
msgid "Add sub-menu"
|
|
msgstr "Adicionar sub-menu"
|
|
|
|
#: tfrmoptionsfavoritetabs.micollapseall.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.micollapseall.caption"
|
|
msgid "Collapse all"
|
|
msgstr "Expandir tudo"
|
|
|
|
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption"
|
|
msgid "...current level of item(s) selected only"
|
|
msgstr "... nível atual somente de itens selecionados"
|
|
|
|
#: tfrmoptionsfavoritetabs.micutselection.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.micutselection.caption"
|
|
msgid "Cut"
|
|
msgstr "Cortar"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption"
|
|
msgid "delete all!"
|
|
msgstr "excluir todos"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption"
|
|
msgid "sub-menu and all its elements"
|
|
msgstr "sub-menu e todos seus elemento.s"
|
|
|
|
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mideletejustsubmenu.caption"
|
|
msgid "just sub-menu but keep elements"
|
|
msgstr "Apenas sub-menu, mas manter os elementos."
|
|
|
|
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry.caption"
|
|
msgid "selected item"
|
|
msgstr "item selecionado."
|
|
|
|
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mideleteselectedentry2.caption"
|
|
msgid "Delete selected item"
|
|
msgstr "Excluir item selecionado."
|
|
|
|
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
|
|
msgid "Export selection to legacy .tab file(s)"
|
|
msgstr "Exportar seleção para arquivos .tab legado."
|
|
|
|
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
|
|
msgid "FavoriteTabsTestMenu"
|
|
msgstr "FavoriteTabsTestMenu"
|
|
|
|
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
|
|
msgid "Import legacy .tab file(s) according to default setting"
|
|
msgstr "Importar arquivo(s) .tab legado de acordo com a configuração padrão."
|
|
|
|
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption"
|
|
msgid "Import legacy .tab file(s) at selected position"
|
|
msgstr "Importar arquivo(s) .tab legado(s) na posição selecionada."
|
|
|
|
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
|
|
msgid "Import legacy .tab file(s) at selected position"
|
|
msgstr "Importar arquivo(s) .tab legado(s) na posição selecionada."
|
|
|
|
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
|
|
msgid "Import legacy .tab file(s) at selected position in a sub menu"
|
|
msgstr "Importar arquivo(s) .tab legado(s) na posição selecionada em um sub-menu"
|
|
|
|
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
|
|
msgid "Insert separator"
|
|
msgstr "Inserir guia"
|
|
|
|
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
|
|
msgid "Insert sub-menu"
|
|
msgstr "Inserir sub-menu"
|
|
|
|
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miopenallbranches.caption"
|
|
msgid "Open all branches"
|
|
msgstr "Abrir todos os ramos"
|
|
|
|
#: tfrmoptionsfavoritetabs.mipasteselection.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mipasteselection.caption"
|
|
msgid "Paste"
|
|
msgstr "Colar"
|
|
|
|
#: tfrmoptionsfavoritetabs.mirename.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mirename.caption"
|
|
msgid "Rename"
|
|
msgstr "Renomear"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator1.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator10.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator10.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator11.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator11.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator2.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator3.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator3.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator7.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator7.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator8.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator8.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.miseparator9.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.miseparator9.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfavoritetabs.misorteverything.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.misorteverything.caption"
|
|
msgid "...everything, from A to Z!"
|
|
msgstr "...tudo. De A a Z"
|
|
|
|
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup.caption"
|
|
msgid "...single group of item(s) only"
|
|
msgstr "...somente grupo simples de itens"
|
|
|
|
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.misortsinglegroup2.caption"
|
|
msgid "Sort single group of item(s) only"
|
|
msgstr "Sortear somente grupo simples de itens."
|
|
|
|
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.misortsinglesubmenu.caption"
|
|
msgid "...content of submenu(s) selected, no sublevel"
|
|
msgstr "...conteúdo do sub-menu selecionado, no sub-nível."
|
|
|
|
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption"
|
|
msgid "...content of submenu(s) selected and all sublevels"
|
|
msgstr "... conteúdo do(s) submenu(s) selecionado(s) e todos os subníveis."
|
|
|
|
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
|
|
msgctxt "tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption"
|
|
msgid "Test resulting menu"
|
|
msgstr "Testar menus resultantes"
|
|
|
|
#: tfrmoptionsfileassoc.btnaddact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnaddact.caption"
|
|
msgid "Add"
|
|
msgstr "Adicionar"
|
|
|
|
#: tfrmoptionsfileassoc.btnaddext.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnaddext.caption"
|
|
msgid "&Add"
|
|
msgstr "&Adicionar"
|
|
|
|
#: tfrmoptionsfileassoc.btnaddnewtype.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnaddnewtype.caption"
|
|
msgid "A&dd"
|
|
msgstr "A&dicionar"
|
|
|
|
#: tfrmoptionsfileassoc.btncloneact.caption
|
|
msgid "Clone"
|
|
msgstr "Clone"
|
|
|
|
#: tfrmoptionsfileassoc.btndownact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btndownact.caption"
|
|
msgid "&Down"
|
|
msgstr "A&baixo"
|
|
|
|
#: tfrmoptionsfileassoc.btneditext.caption
|
|
msgctxt "tfrmoptionsfileassoc.btneditext.caption"
|
|
msgid "Edit"
|
|
msgstr "Editar"
|
|
|
|
#: tfrmoptionsfileassoc.btninsertact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
|
|
msgid "Insert"
|
|
msgstr "Inserir"
|
|
|
|
#: tfrmoptionsfileassoc.btninsertext.caption
|
|
msgctxt "tfrmoptionsfileassoc.btninsertext.caption"
|
|
msgid "Insert"
|
|
msgstr "Inserir"
|
|
|
|
#: tfrmoptionsfileassoc.btnremoveact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnremoveact.caption"
|
|
msgid "Remo&ve"
|
|
msgstr "Remo&ver"
|
|
|
|
#: tfrmoptionsfileassoc.btnremoveext.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnremoveext.caption"
|
|
msgid "Re&move"
|
|
msgstr "Re&mover"
|
|
|
|
#: tfrmoptionsfileassoc.btnremovetype.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnremovetype.caption"
|
|
msgid "&Remove"
|
|
msgstr "&Remover"
|
|
|
|
#: tfrmoptionsfileassoc.btnrenametype.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
|
|
msgid "R&ename"
|
|
msgstr "R&enomear"
|
|
|
|
#: tfrmoptionsfileassoc.btnupact.caption
|
|
msgctxt "tfrmoptionsfileassoc.btnupact.caption"
|
|
msgid "&Up"
|
|
msgstr "A&cima"
|
|
|
|
#: tfrmoptionsfileassoc.destartpath.hint
|
|
msgid "Starting path of the command. Never quote this string."
|
|
msgstr "Caminho inicial do comando. Nunca citar esta seqüência."
|
|
|
|
#: tfrmoptionsfileassoc.edbactionname.hint
|
|
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
|
|
msgstr "Nome da ação. Nunca é passado para o sistema, é apenas um nome mnemônico escolhido por você, para você."
|
|
|
|
#: tfrmoptionsfileassoc.edtparams.hint
|
|
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
|
|
msgstr "Parâmetro para passar para o comando. Nome de arquivo longo com espaços deve ser citado."
|
|
|
|
#: tfrmoptionsfileassoc.fnecommand.hint
|
|
msgid "Command to execute. Long filename with space should be quoted."
|
|
msgstr "Comando a ser executado. O nome de arquivo longo com espaço deve ser citado."
|
|
|
|
#: tfrmoptionsfileassoc.gbactiondescription.caption
|
|
msgid "Action description:"
|
|
msgstr "Descrição da ação:"
|
|
|
|
#: tfrmoptionsfileassoc.gbactions.caption
|
|
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
|
|
msgid "Actions"
|
|
msgstr "Ações"
|
|
|
|
#: tfrmoptionsfileassoc.gbexts.caption
|
|
msgctxt "tfrmoptionsfileassoc.gbexts.caption"
|
|
msgid "Extensions"
|
|
msgstr "Extensões"
|
|
|
|
#: tfrmoptionsfileassoc.gbexts.hint
|
|
msgid "Can be sorted by drag & drop"
|
|
msgstr "Pode ser ordenado com arrastar e soltar"
|
|
|
|
#: tfrmoptionsfileassoc.gbfiletypes.caption
|
|
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
|
|
msgid "File types"
|
|
msgstr "Tipos de arquivo"
|
|
|
|
#: tfrmoptionsfileassoc.gbicon.caption
|
|
msgctxt "tfrmoptionsfileassoc.gbicon.caption"
|
|
msgid "Icon"
|
|
msgstr "Ícone"
|
|
|
|
#: tfrmoptionsfileassoc.lbactions.hint
|
|
msgid "Actions may be sorted by drag & drop"
|
|
msgstr "Ações podem ser ordenadas com arrastar e soltar"
|
|
|
|
#: tfrmoptionsfileassoc.lbexts.hint
|
|
msgid "Extensions may be sorted by drag & drop"
|
|
msgstr "Extensões podem ser ordenadas com arrastar e soltar"
|
|
|
|
#: tfrmoptionsfileassoc.lbfiletypes.hint
|
|
msgid "File types may be sorted by drag & drop"
|
|
msgstr "Tipos de arquivos podem ser sorteados por arrastar e soltar."
|
|
|
|
#: tfrmoptionsfileassoc.lblaction.caption
|
|
msgctxt "tfrmoptionsfileassoc.lblaction.caption"
|
|
msgid "Action name:"
|
|
msgstr "Nome ação:"
|
|
|
|
#: tfrmoptionsfileassoc.lblcommand.caption
|
|
msgctxt "tfrmoptionsfileassoc.lblcommand.caption"
|
|
msgid "&Command:"
|
|
msgstr "&Comando:"
|
|
|
|
#: tfrmoptionsfileassoc.lblexternalparameters.caption
|
|
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
|
|
msgid "Parameter&s:"
|
|
msgstr "Parâmetro&s:"
|
|
|
|
#: tfrmoptionsfileassoc.lblstartpath.caption
|
|
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
|
|
msgid "Start pat&h:"
|
|
msgstr "Camin&ho inicial:"
|
|
|
|
#: tfrmoptionsfileassoc.menuitem1.caption
|
|
msgctxt "tfrmoptionsfileassoc.menuitem1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfileassoc.menuitem3.caption
|
|
msgid "Custom with..."
|
|
msgstr "Customizar com..."
|
|
|
|
#: tfrmoptionsfileassoc.micustom.caption
|
|
msgid "Custom"
|
|
msgstr "Personalizar"
|
|
|
|
#: tfrmoptionsfileassoc.miedit.caption
|
|
msgctxt "tfrmoptionsfileassoc.miedit.caption"
|
|
msgid "Edit"
|
|
msgstr "Editar"
|
|
|
|
#: tfrmoptionsfileassoc.mieditor.caption
|
|
msgctxt "tfrmoptionsfileassoc.mieditor.caption"
|
|
msgid "Open in Editor"
|
|
msgstr "Abrir no editor"
|
|
|
|
#: tfrmoptionsfileassoc.mieditwith.caption
|
|
msgid "Edit with..."
|
|
msgstr "Editar com"
|
|
|
|
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
|
|
msgctxt "tfrmoptionsfileassoc.migetoutputfromcommand.caption"
|
|
msgid "Get output from command"
|
|
msgstr "Obter saída do comando"
|
|
|
|
#: tfrmoptionsfileassoc.miinternaleditor.caption
|
|
msgid "Open in Internal Editor"
|
|
msgstr "Abrir no Editor Interno."
|
|
|
|
#: tfrmoptionsfileassoc.miinternalviewer.caption
|
|
msgid "Open in Internal Viewer"
|
|
msgstr "Abrir na Visão Interna"
|
|
|
|
#: tfrmoptionsfileassoc.miopen.caption
|
|
msgctxt "tfrmoptionsfileassoc.miopen.caption"
|
|
msgid "Open"
|
|
msgstr "Abrir"
|
|
|
|
#: tfrmoptionsfileassoc.miopenwith.caption
|
|
msgid "Open with..."
|
|
msgstr "Abrir com"
|
|
|
|
#: tfrmoptionsfileassoc.miseparator.caption
|
|
msgctxt "tfrmoptionsfileassoc.miseparator.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionsfileassoc.mishell.caption
|
|
msgctxt "tfrmoptionsfileassoc.mishell.caption"
|
|
msgid "Run in terminal"
|
|
msgstr "Executar no terminal."
|
|
|
|
#: tfrmoptionsfileassoc.miview.caption
|
|
msgctxt "tfrmoptionsfileassoc.miview.caption"
|
|
msgid "View"
|
|
msgstr "Ver"
|
|
|
|
#: tfrmoptionsfileassoc.miviewer.caption
|
|
msgctxt "tfrmoptionsfileassoc.miviewer.caption"
|
|
msgid "Open in Viewer"
|
|
msgstr "Abrir no visualizador"
|
|
|
|
#: tfrmoptionsfileassoc.miviewwith.caption
|
|
msgid "View with..."
|
|
msgstr "Ver com..."
|
|
|
|
#: tfrmoptionsfileassoc.sbtnicon.hint
|
|
msgid "Click me to change icon!"
|
|
msgstr "Clicar para alterar o ícone!"
|
|
|
|
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
|
|
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
|
|
msgid "Execute via shell"
|
|
msgstr "Executar via shell."
|
|
|
|
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
|
|
msgid "Extended context menu"
|
|
msgstr "Menu de contexto estendido."
|
|
|
|
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
|
|
msgid "File association configuration"
|
|
msgstr "Configuração de associação de arquivo."
|
|
|
|
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
|
|
msgid "Offer to add selection to file association when not included already"
|
|
msgstr "Oferecer para adicionar seleção a associação de arquivo quando não estiver incluído."
|
|
|
|
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
|
|
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
|
|
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
|
|
msgstr "Ao acessar a associação de arquivo, ofereça para adicionar o arquivo selecionado atual se não já estiver incluído em um tipo de arquivo configurado."
|
|
|
|
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
|
|
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
|
|
msgid "Execute via terminal and close"
|
|
msgstr "Executar via terminal e fechar."
|
|
|
|
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
|
|
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
|
|
msgid "Execute via terminal and stay open"
|
|
msgstr "Executar via terminal e manter aberto."
|
|
|
|
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
|
|
msgid "Extended options items:"
|
|
msgstr "Opções estendidas dos itens:"
|
|
|
|
#: tfrmoptionsfileoperations.bvlconfirmations.caption
|
|
msgctxt "tfrmoptionsfileoperations.bvlconfirmations.caption"
|
|
msgid "Show confirmation window for:"
|
|
msgstr "Mostrar diálogo de confirmação para:"
|
|
|
|
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
|
|
msgid "Cop&y operation"
|
|
msgstr "Operação Cop&iar."
|
|
|
|
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
|
|
msgid "&Delete operation"
|
|
msgstr "Operação &Excluir."
|
|
|
|
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
|
|
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
|
|
msgstr "Exluir para a lixeira(a tecla Shift reverte esta definição)."
|
|
|
|
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
|
|
msgid "D&elete to trash operation"
|
|
msgstr "Operação excluir para lixeira"
|
|
|
|
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
|
|
msgctxt "TFRMOPTIONSFILEOPERATIONS.CBDROPREADONLYFLAG.CAPTION"
|
|
msgid "D&rop readonly flag"
|
|
msgstr "Soltar flag somente leitura."
|
|
|
|
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
|
|
msgid "&Move operation"
|
|
msgstr "Operação &Mover."
|
|
|
|
#: tfrmoptionsfileoperations.cbprocesscomments.caption
|
|
msgid "&Process comments with files/folders"
|
|
msgstr "&Comentários do processo com arquivos/pastas"
|
|
|
|
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
|
|
msgid "Select &file name without extension when renaming"
|
|
msgstr "Selecionar nome de &arquivo sem extensão ao renomear."
|
|
|
|
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
|
|
msgid "Sho&w tab select panel in copy/move dialog"
|
|
msgstr "Mos&trar painel de seleção de guia no diálogo Copiar/Mover."
|
|
|
|
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
|
|
msgid "S&kip file operations errors and write them to log window"
|
|
msgstr "Saltar erros de &operações de arquivos e escrevê-los no log."
|
|
|
|
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
|
|
msgid "Executing operations"
|
|
msgstr "Executando operações."
|
|
|
|
#: tfrmoptionsfileoperations.gbuserinterface.caption
|
|
msgid "User interface"
|
|
msgstr "Interface do usuário."
|
|
|
|
#: tfrmoptionsfileoperations.lblbuffersize.caption
|
|
msgid "&Buffer size for file operations (in KB):"
|
|
msgstr "Tamanho do buffer para operações de arquivos (em KB):"
|
|
|
|
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
|
|
msgid "Buffer size for &hash calculation (in KB):"
|
|
msgstr "Tamanho do buffer para cálculo do hash (em KB):"
|
|
|
|
#: tfrmoptionsfileoperations.lblprogresskind.caption
|
|
msgid "Show operations progress &initially in"
|
|
msgstr "Mostrar progresso da operação &inicialmente em"
|
|
|
|
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
|
|
msgctxt "tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption"
|
|
msgid "Duplicated name auto-rename style:"
|
|
msgstr "Renoeação automática do estilo para nome duplicado."
|
|
|
|
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
|
|
msgid "&Number of wipe passes:"
|
|
msgstr "&Número de passagens de limpeza."
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.btncursorbordercolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btncursortext.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
|
|
msgid "Reset to DC default"
|
|
msgstr "Reiniciar DC para padrão."
|
|
|
|
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.cballowovercolor.caption"
|
|
msgid "Allow Overcolor"
|
|
msgstr "Permitir cor sobreposta."
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
|
|
msgid "Use &Frame Cursor"
|
|
msgstr "Use &Frame Cursor"
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
|
|
msgid "Use &Gradient Indicator"
|
|
msgstr "Usar indicador &gradiente."
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
|
|
msgid "Use Inactive Sel Color"
|
|
msgstr "Usar Cor Selecionada Inativa."
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
|
|
msgid "U&se Inverted Selection"
|
|
msgstr "U&sar seleção invertida."
|
|
|
|
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.cbusecursorborder.caption"
|
|
msgid "Cursor border"
|
|
msgstr "Contorno do cursor"
|
|
|
|
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.DBFREESPACEINDICATOR.CAPTION"
|
|
msgid "Drive Free Space Indicator"
|
|
msgstr "Indicador de espaço livre na unidade."
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
|
|
msgid "Bac&kground:"
|
|
msgstr "F&undo:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLBACKGROUNDCOLOR2.CAPTION"
|
|
msgid "Backg&round 2:"
|
|
msgstr "Fu&ndo 2:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORCOLOR.CAPTION"
|
|
msgid "C&ursor Color:"
|
|
msgstr "Cor do c&ursor:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLCURSORTEXT.CAPTION"
|
|
msgid "Cursor Te&xt:"
|
|
msgstr "Te&xto do cursor:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption"
|
|
msgid "Inactive Cursor Color:"
|
|
msgstr "Cor do Cursor Inativo:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
|
|
msgctxt "tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption"
|
|
msgid "Inactive Mark Color:"
|
|
msgstr "Cor da Marca Inativa:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
|
|
msgid "&Brightness level of inactive panel"
|
|
msgstr "Nível de &brilho do painel inativo."
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
|
|
msgid "In&dicator Back Color:"
|
|
msgstr "Cor de fundo do in&dicador:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
|
|
msgid "&Indicator Fore Color:"
|
|
msgstr "Cor 1º plano do &indicador:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLMARKCOLOR.CAPTION"
|
|
msgid "&Mark Color:"
|
|
msgstr "Cor da &marca:"
|
|
|
|
#: tfrmoptionsfilepanelscolors.lblpreview.caption
|
|
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
|
|
msgstr "Abaixo está uma pré-visualização. Você pode mover o cursor, selecionar o arquivo e obter imediatamente uma aparência real das várias configurações."
|
|
|
|
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
|
|
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLTEXTCOLOR.CAPTION"
|
|
msgid "T&ext Color:"
|
|
msgstr "Cor do t&exto:"
|
|
|
|
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
|
|
msgid "When launching file search, clear file mask filter"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesearch.cbpartialnamesearch.caption"
|
|
msgid "&Search for part of file name"
|
|
msgstr "&Procurar parte do nome do arquivo"
|
|
|
|
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
|
|
msgid "Show menu bar in \"Find files\""
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesearch.dbtextsearch.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesearch.dbtextsearch.caption"
|
|
msgid "Text search in files"
|
|
msgstr "Pesquisar texto em arquivos."
|
|
|
|
#: tfrmoptionsfilesearch.gbfilesearch.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesearch.gbfilesearch.caption"
|
|
msgid "File search"
|
|
msgstr "Localizar arquivo"
|
|
|
|
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
|
|
msgid "Current filters with \"New search\" button:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption"
|
|
msgid "Default search template:"
|
|
msgstr "Pesquisar modelo padrão:"
|
|
|
|
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesearch.rbusemmapinsearch.caption"
|
|
msgid "Use memory mapping for search te&xt in files"
|
|
msgstr "Usar mapa de memória para procura de te&xto em arquivos."
|
|
|
|
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesearch.rbusestreaminsearch.caption"
|
|
msgid "&Use stream for search text in files"
|
|
msgstr "&Usar stream para procurar texto em arquivos."
|
|
|
|
#: tfrmoptionsfilesviews.btnaddattribute.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesviews.btnaddattribute.caption"
|
|
msgid "&Add"
|
|
msgstr "&Adicionar"
|
|
|
|
#: tfrmoptionsfilesviews.btnattrshelp.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfilesviews.btnattrshelp.caption"
|
|
msgid "&Help"
|
|
msgstr "A&juda"
|
|
|
|
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
|
|
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
|
|
msgid "Do&n't load file list until a tab is activated"
|
|
msgstr "&Não carregar lista de arquivos até um guia estar ativo."
|
|
|
|
#: tfrmoptionsfilesviews.cbdirbrackets.caption
|
|
msgid "S&how square brackets around directories"
|
|
msgstr "Mostrar pastas entre parênteses retos."
|
|
|
|
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
|
|
msgid "Hi&ghlight new and updated files"
|
|
msgstr "Rea&lçar arquivos novos e atualizados."
|
|
|
|
#: tfrmoptionsfilesviews.cbinplacerename.caption
|
|
msgid "Enable inplace &renaming when clicking twice on a name"
|
|
msgstr "Ativar inplace e renomear ao clicar duas vezes em um nome."
|
|
|
|
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.CBLISTFILESINTHREAD.CAPTION"
|
|
msgid "Load &file list in separate thread"
|
|
msgstr "Carregar lista de &arquivos em linha separada."
|
|
|
|
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.CBLOADICONSSEPARATELY.CAPTION"
|
|
msgid "Load icons af&ter file list"
|
|
msgstr "Carregar ícones depois da lis&ta de arquivos."
|
|
|
|
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
|
|
msgctxt "TFRMOPTIONSFILESVIEWS.CBSHOWSYSTEMFILES.CAPTION"
|
|
msgid "Show s&ystem and hidden files"
|
|
msgstr "Mostrar arquivos ocultos e de s&istema."
|
|
|
|
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
|
|
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
|
|
msgstr "Ao selecionar arquivos com a <BARRA DE ESPAÇO>, mover para o próximo arquivo (tal como com <INSERT>)."
|
|
|
|
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
|
|
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
|
|
msgid "Use an independent attribute filter in mask input dialog each time"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.gbformatting.caption
|
|
msgid "Formatting"
|
|
msgstr "Formatação"
|
|
|
|
#: tfrmoptionsfilesviews.gbmarking.caption
|
|
msgid "Marking/Unmarking entries"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.gbsorting.caption
|
|
msgid "Sorting"
|
|
msgstr "Ordenando"
|
|
|
|
#: tfrmoptionsfilesviews.lbattributemask.caption
|
|
msgid "Default attribute mask value to use:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
|
|
msgid "Case s&ensitivity:"
|
|
msgstr "S&ensibilidade a maiúsculas:"
|
|
|
|
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
|
|
msgid "Incorrect format"
|
|
msgstr "Formato incorreto"
|
|
|
|
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
|
|
msgid "&Date and time format:"
|
|
msgstr "Formato de &data e hora:"
|
|
|
|
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
|
|
msgid "File si&ze format:"
|
|
msgstr "Formato do ta&manho de arquivo:"
|
|
|
|
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
|
|
#, fuzzy
|
|
#| msgid "&Insert new files"
|
|
msgid "&Insert new files:"
|
|
msgstr "&Inserir novos arquivos:"
|
|
|
|
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
|
|
msgid "So&rting directories:"
|
|
msgstr "Ordenando pastas:"
|
|
|
|
#: tfrmoptionsfilesviews.lblsortmethod.caption
|
|
msgid "&Sort method:"
|
|
msgstr "Método de &ordenação:"
|
|
|
|
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
|
|
#, fuzzy
|
|
#| msgid "&Move updated files"
|
|
msgid "&Move updated files:"
|
|
msgstr "&Mover arquivos atualizados:"
|
|
|
|
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
|
|
msgid "A&dd"
|
|
msgstr "A&dicionar"
|
|
|
|
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
|
|
msgid "A&pply"
|
|
msgstr "A&plicar"
|
|
|
|
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
|
|
msgid "D&elete"
|
|
msgstr "&Excluir"
|
|
|
|
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNSEARCHTEMPLATE.HINT"
|
|
msgid "Template..."
|
|
msgstr "Modelo..."
|
|
|
|
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
|
|
msgid "File types colors (sort by drag&&drop)"
|
|
msgstr "Cores de tipos de arquivos (ordenar com arrastar e largar)."
|
|
|
|
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
|
|
msgid "Category a&ttributes:"
|
|
msgstr "A&tributos de categoria:"
|
|
|
|
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
|
|
msgid "Category co&lor:"
|
|
msgstr "Cor da cate&goria:"
|
|
|
|
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYMASK.CAPTION"
|
|
msgid "Category &mask:"
|
|
msgstr "&Máscara de categoria:"
|
|
|
|
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
|
|
msgctxt "TFRMOPTIONSFILETYPESCOLORS.LBLCATEGORYNAME.CAPTION"
|
|
msgid "Category &name:"
|
|
msgstr "&Nome de categoria:"
|
|
|
|
#: tfrmoptionsfonts.btnpatheditfnt.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfonts.btnpatheditfnt.caption"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsfonts.btnsearchresultsfnt.caption"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnselconsolefnt.caption
|
|
msgctxt "tfrmoptionsfonts.btnselconsolefnt.caption"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnseleditfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnsellogfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnselmainfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.btnselviewfnt.caption
|
|
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmoptionsfonts.lblconsolefont.caption
|
|
msgid "&Console font"
|
|
msgstr "&Fonte do console"
|
|
|
|
#: tfrmoptionsfonts.lbleditorfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLEDITORFONT.CAPTION"
|
|
msgid "&Editor font"
|
|
msgstr "Letra do &editor"
|
|
|
|
#: tfrmoptionsfonts.lbllogfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLLOGFONT.CAPTION"
|
|
msgid "&Log font"
|
|
msgstr "Fonte do log"
|
|
|
|
#: tfrmoptionsfonts.lblmainfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLMAINFONT.CAPTION"
|
|
msgid "Main &font"
|
|
msgstr "&Letra do programa"
|
|
|
|
#: tfrmoptionsfonts.lblpatheditfont.caption
|
|
msgid "Path font"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfonts.lblsearchresultsfont.caption
|
|
msgid "Search results font"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsfonts.lblviewerbookfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERBOOKFONT.CAPTION"
|
|
msgid "Viewer&Book Font"
|
|
msgstr "Letra do vis&ualizador de livro"
|
|
|
|
#: tfrmoptionsfonts.lblviewerfont.caption
|
|
msgctxt "TFRMOPTIONSFONTS.LBLVIEWERFONT.CAPTION"
|
|
msgid "&Viewer font"
|
|
msgstr "Letra do visuali&zador"
|
|
|
|
#: tfrmoptionshotkeys.actaddhotkey.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actaddhotkey.caption"
|
|
msgid "Add &hotkey"
|
|
msgstr "Adicionar atal&ho"
|
|
|
|
#: tfrmoptionshotkeys.actcopy.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actcopy.caption"
|
|
msgid "Copy"
|
|
msgstr "Copiar"
|
|
|
|
#: tfrmoptionshotkeys.actdelete.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actdelete.caption"
|
|
msgid "Delete"
|
|
msgstr "Excluir"
|
|
|
|
#: tfrmoptionshotkeys.actdeletehotkey.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actdeletehotkey.caption"
|
|
msgid "&Delete hotkey"
|
|
msgstr "&Excluir atalho"
|
|
|
|
#: tfrmoptionshotkeys.actedithotkey.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actedithotkey.caption"
|
|
msgid "&Edit hotkey"
|
|
msgstr "&Editar atalho"
|
|
|
|
#: tfrmoptionshotkeys.actnextcategory.caption
|
|
msgid "Next category"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
|
|
msgid "Make popup the file related menu"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actpreviouscategory.caption
|
|
msgid "Previous category"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actrename.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.actrename.caption"
|
|
msgid "Rename"
|
|
msgstr "Renomear"
|
|
|
|
#: tfrmoptionshotkeys.actrestoredefault.caption
|
|
msgid "Restore DC default"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actsavenow.caption
|
|
msgid "Save now"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actsortbycommand.caption
|
|
msgid "Sort by command name"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
|
|
msgid "Sort by hotkeys (grouped)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
|
|
msgid "Sort by hotkeys (one per row)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.lbfilter.caption
|
|
msgctxt "TFRMOPTIONSHOTKEYS.LBFILTER.CAPTION"
|
|
msgid "&Filter"
|
|
msgstr "&Filtro"
|
|
|
|
#: tfrmoptionshotkeys.lblcategories.caption
|
|
msgctxt "TFRMOPTIONSHOTKEYS.LBLCATEGORIES.CAPTION"
|
|
msgid "C&ategories:"
|
|
msgstr "C&ategorias:"
|
|
|
|
#: tfrmoptionshotkeys.lblcommands.caption
|
|
msgctxt "TFRMOPTIONSHOTKEYS.LBLCOMMANDS.CAPTION"
|
|
msgid "Co&mmands:"
|
|
msgstr "Co&mandos:"
|
|
|
|
#: tfrmoptionshotkeys.lblscfiles.caption
|
|
msgctxt "TFRMOPTIONSHOTKEYS.LBLSCFILES.CAPTION"
|
|
msgid "&Shortcut files:"
|
|
msgstr "Arquivo&s de atalho:"
|
|
|
|
#: tfrmoptionshotkeys.lblsortorder.caption
|
|
msgid "So&rt order:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.micategories.caption
|
|
msgid "Categories"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionshotkeys.micommands.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.micommands.caption"
|
|
msgid "Command"
|
|
msgstr "Commando"
|
|
|
|
#: tfrmoptionshotkeys.miseparator1.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionshotkeys.miseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionshotkeys.misortorder.caption
|
|
msgid "Sort order"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.cbiconsexclude.caption
|
|
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
|
|
msgid "For the following &paths and their subdirectories:"
|
|
msgstr "Para os seguintes caminhos e sub&pastas:"
|
|
|
|
#: tfrmoptionsicons.cbiconsinmenus.caption
|
|
msgid "Show icons for actions in &menus"
|
|
msgstr "Mostrar ícones para ações nos &menus."
|
|
|
|
#: tfrmoptionsicons.cbiconsinmenussize.text
|
|
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
|
|
msgid "16x16"
|
|
msgstr "16x16"
|
|
|
|
#: tfrmoptionsicons.cbiconsonbuttons.caption
|
|
msgid "Show icons on buttons"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.cbiconsshowoverlay.caption
|
|
msgctxt "TFRMOPTIONSICONS.CBICONSSHOWOVERLAY.CAPTION"
|
|
msgid "Show o&verlay icons, e.g. for links"
|
|
msgstr "Mostrar ícones sobrepostos, i.e. para links."
|
|
|
|
#: tfrmoptionsicons.chkshowhiddendimmed.caption
|
|
msgid "&Dimmed hidden files (slower)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.gbdisablespecialicons.caption
|
|
msgid "Disable special icons"
|
|
msgstr "Desativar ícones especiais."
|
|
|
|
#: tfrmoptionsicons.gbiconssize.caption
|
|
msgctxt "TFRMOPTIONSICONS.GBICONSSIZE.CAPTION"
|
|
msgid " Icon size "
|
|
msgstr "Tamanho do ícone."
|
|
|
|
#: tfrmoptionsicons.gbicontheme.caption
|
|
msgid "Icon theme"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.gbshowicons.caption
|
|
msgid "Show icons"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.gbshowiconsmode.caption
|
|
msgctxt "TFRMOPTIONSICONS.GBSHOWICONSMODE.CAPTION"
|
|
msgid " Show icons to the left of the filename "
|
|
msgstr "Mostrar ícones à esquerda do nome de arquivo."
|
|
|
|
#: tfrmoptionsicons.lbldiskpanel.caption
|
|
msgid "Disk panel:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.lblfilepanel.caption
|
|
msgid "File panel:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsicons.rbiconsshowall.caption
|
|
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALL.CAPTION"
|
|
msgid "A&ll"
|
|
msgstr "T&udo"
|
|
|
|
#: tfrmoptionsicons.rbiconsshowallandexe.caption
|
|
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWALLANDEXE.CAPTION"
|
|
msgid "All associated + &EXE/LNK (slow)"
|
|
msgstr "Todos os associados + &EXE/LNK (lento)."
|
|
|
|
#: tfrmoptionsicons.rbiconsshownone.caption
|
|
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWNONE.CAPTION"
|
|
msgid "&No icons"
|
|
msgstr "Sem íco&nes."
|
|
|
|
#: tfrmoptionsicons.rbiconsshowstandard.caption
|
|
msgctxt "TFRMOPTIONSICONS.RBICONSSHOWSTANDARD.CAPTION"
|
|
msgid "Only &standard icons"
|
|
msgstr "Só ícone&s padrão."
|
|
|
|
#: tfrmoptionsignorelist.btnaddsel.caption
|
|
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSEL.CAPTION"
|
|
msgid "A&dd selected names"
|
|
msgstr "A&dicionar nomes selecionados."
|
|
|
|
#: tfrmoptionsignorelist.btnaddselwithpath.caption
|
|
msgctxt "TFRMOPTIONSIGNORELIST.BTNADDSELWITHPATH.CAPTION"
|
|
msgid "Add selected names with &full path"
|
|
msgstr "Adicionar nomes selecionados com caminho completo."
|
|
|
|
#: tfrmoptionsignorelist.btnrelativesavein.hint
|
|
msgctxt "tfrmoptionsignorelist.btnrelativesavein.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Algumas funções para selecionar caminho correto."
|
|
|
|
#: tfrmoptionsignorelist.chkignoreenable.caption
|
|
msgctxt "TFRMOPTIONSIGNORELIST.CHKIGNOREENABLE.CAPTION"
|
|
msgid "&Ignore (don't show) the following files and folders:"
|
|
msgstr "&Ignorar /não mostrar) os arquivos e pastas seguintes:"
|
|
|
|
#: tfrmoptionsignorelist.lblsavein.caption
|
|
msgctxt "TFRMOPTIONSIGNORELIST.LBLSAVEIN.CAPTION"
|
|
msgid "&Save in:"
|
|
msgstr "&Salvar em:"
|
|
|
|
#: tfrmoptionskeyboard.cblynxlike.caption
|
|
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
|
|
msgstr "Setas es&querda e direita mudam a pasta (movimento tipo Lynx)."
|
|
|
|
#: tfrmoptionskeyboard.gbtyping.caption
|
|
msgid "Typing"
|
|
msgstr "Digitando"
|
|
|
|
#: tfrmoptionskeyboard.lblalt.caption
|
|
#, fuzzy
|
|
#| msgid "Alt+L&etters"
|
|
msgctxt "TFRMOPTIONSKEYBOARD.LBLALT.CAPTION"
|
|
msgid "Alt+L&etters:"
|
|
msgstr "Alt+L&etras"
|
|
|
|
#: tfrmoptionskeyboard.lblctrlalt.caption
|
|
#, fuzzy
|
|
#| msgid "Ctrl+Alt+Le&tters"
|
|
msgctxt "TFRMOPTIONSKEYBOARD.LBLCTRLALT.CAPTION"
|
|
msgid "Ctrl+Alt+Le&tters:"
|
|
msgstr "Ctrl+Alt+Le&tras"
|
|
|
|
#: tfrmoptionskeyboard.lblnomodifier.caption
|
|
#, fuzzy
|
|
#| msgid "&Letters"
|
|
msgctxt "TFRMOPTIONSKEYBOARD.LBLNOMODIFIER.CAPTION"
|
|
msgid "&Letters:"
|
|
msgstr "&Letras"
|
|
|
|
#: tfrmoptionslayout.cbflatdiskpanel.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBFLATDISKPANEL.CAPTION"
|
|
msgid "&Flat buttons"
|
|
msgstr "Botões p&lanos."
|
|
|
|
#: tfrmoptionslayout.cbflatinterface.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBFLATINTERFACE.CAPTION"
|
|
msgid "Flat i&nterface"
|
|
msgstr "Ambiente pla&no."
|
|
|
|
#: tfrmoptionslayout.cbflattoolbar.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBFLATTOOLBAR.CAPTION"
|
|
msgid "Flat b&uttons"
|
|
msgstr "B&otões planos."
|
|
|
|
#: tfrmoptionslayout.cbfreespaceind.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBFREESPACEIND.CAPTION"
|
|
msgid "Show fr&ee space indicator on drive label"
|
|
msgstr "Mostrar &espaço livre no rótulo da unidade."
|
|
|
|
#: tfrmoptionslayout.cblogwindow.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBLOGWINDOW.CAPTION"
|
|
msgid "Show lo&g window"
|
|
msgstr "Mostrar &janela de log."
|
|
|
|
#: tfrmoptionslayout.cbpanelofoperations.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBPANELOFOPERATIONS.CAPTION"
|
|
msgid "Show panel of operation in background"
|
|
msgstr "Mostrar painel de operações em 2º plano."
|
|
|
|
#: tfrmoptionslayout.cbproginmenubar.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBPROGINMENUBAR.CAPTION"
|
|
msgid "Show common progress in menu bar"
|
|
msgstr "Mostrar progresso comum na barra de menu."
|
|
|
|
#: tfrmoptionslayout.cbshowcmdline.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCMDLINE.CAPTION"
|
|
msgid "Show command l&ine"
|
|
msgstr "Mostrar l&inha de comandos."
|
|
|
|
#: tfrmoptionslayout.cbshowcurdir.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWCURDIR.CAPTION"
|
|
msgid "Show current director&y"
|
|
msgstr "Mostrar pasta at&ual."
|
|
|
|
#: tfrmoptionslayout.cbshowdiskpanel.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDISKPANEL.CAPTION"
|
|
msgid "Show &drive buttons"
|
|
msgstr "Mostrar botões de uni&dade."
|
|
|
|
#: tfrmoptionslayout.cbshowdrivefreespace.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWDRIVEFREESPACE.CAPTION"
|
|
msgid "Show free s&pace label"
|
|
msgstr "Mostrar rótulo de es&paço livre."
|
|
|
|
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
|
|
msgid "Show drives list bu&tton"
|
|
msgstr "Mostrar bo&tão da lista de unidades."
|
|
|
|
#: tfrmoptionslayout.cbshowkeyspanel.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWKEYSPANEL.CAPTION"
|
|
msgid "Show function &key buttons"
|
|
msgstr "Mostrar botões de teclas de função."
|
|
|
|
#: tfrmoptionslayout.cbshowmainmenu.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINMENU.CAPTION"
|
|
msgid "Show &main menu"
|
|
msgstr "Mostrar &menu principal."
|
|
|
|
#: tfrmoptionslayout.cbshowmaintoolbar.caption
|
|
#, fuzzy
|
|
#| msgid "Show &button bar"
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWMAINTOOLBAR.CAPTION"
|
|
msgid "Show tool&bar"
|
|
msgstr "Mostrar barra de &botões."
|
|
|
|
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
|
|
msgid "Show short free space &label"
|
|
msgstr "Mostrar rótulo curto de espaço &livre."
|
|
|
|
#: tfrmoptionslayout.cbshowstatusbar.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWSTATUSBAR.CAPTION"
|
|
msgid "Show &status bar"
|
|
msgstr "Mostrar barra de e&stado."
|
|
|
|
#: tfrmoptionslayout.cbshowtabheader.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABHEADER.CAPTION"
|
|
msgid "S&how tabstop header"
|
|
msgstr "Mostrar cabeçalho de tabulação."
|
|
|
|
#: tfrmoptionslayout.cbshowtabs.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBSHOWTABS.CAPTION"
|
|
msgid "Sho&w folder tabs"
|
|
msgstr "M&ostrar guias de pasta."
|
|
|
|
#: tfrmoptionslayout.cbtermwindow.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBTERMWINDOW.CAPTION"
|
|
msgid "Show te&rminal window"
|
|
msgstr "Mostrar janela de te&rminal."
|
|
|
|
#: tfrmoptionslayout.cbtwodiskpanels.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.CBTWODISKPANELS.CAPTION"
|
|
msgid "Show two drive button bars (fi&xed width, above file windows)"
|
|
msgstr "Mostrar duas barras de botões de unidade (largura fi&xa, acima das janelas de arquivos)."
|
|
|
|
#: tfrmoptionslayout.gbscreenlayout.caption
|
|
msgctxt "TFRMOPTIONSLAYOUT.GBSCREENLAYOUT.CAPTION"
|
|
msgid " Screen layout "
|
|
msgstr "Disposição da tela."
|
|
|
|
#: tfrmoptionslog.btnrelativelogfile.hint
|
|
msgctxt "tfrmoptionslog.btnrelativelogfile.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Algumas funções para selecionar o caminho apropriado."
|
|
|
|
#: tfrmoptionslog.btnviewlogfile.hint
|
|
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
|
|
msgid "View log file content"
|
|
msgstr "Ver conteúdo do arquivo de log."
|
|
|
|
#: tfrmoptionslog.cbincludedateinlogfilename.caption
|
|
msgid "Include date in log filename"
|
|
msgstr "Incluir data no arquivo de log"
|
|
|
|
#: tfrmoptionslog.cblogarcop.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGARCOP.CAPTION"
|
|
msgid "&Pack/Unpack"
|
|
msgstr "Com&primir/Descomprimir."
|
|
|
|
#: tfrmoptionslog.cblogcommandlineexecution.caption
|
|
msgid "External command line execution"
|
|
msgstr "Linha de execução de comando interno."
|
|
|
|
#: tfrmoptionslog.cblogcpmvln.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGCPMVLN.CAPTION"
|
|
msgid "Cop&y/Move/Create link/symlink"
|
|
msgstr "Cop&iar/Mover/Criar ligação/Ligação simbólica."
|
|
|
|
#: tfrmoptionslog.cblogdelete.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "&Excluir."
|
|
|
|
#: tfrmoptionslog.cblogdirop.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGDIROP.CAPTION"
|
|
msgid "Crea&te/Delete directories"
|
|
msgstr "Criar/Excluir pas&tas."
|
|
|
|
#: tfrmoptionslog.cblogerrors.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGERRORS.CAPTION"
|
|
msgid "Log &errors"
|
|
msgstr "Log de &erros."
|
|
|
|
#: tfrmoptionslog.cblogfile.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGFILE.CAPTION"
|
|
msgid "C&reate a log file:"
|
|
msgstr "C&riar um arquivo de log:"
|
|
|
|
#: tfrmoptionslog.cbloginfo.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGINFO.CAPTION"
|
|
msgid "Log &information messages"
|
|
msgstr "Logde mensagens &informativas."
|
|
|
|
#: tfrmoptionslog.cblogstartshutdown.caption
|
|
msgid "Start/shutdown"
|
|
msgstr "Iniciar/Desligar."
|
|
|
|
#: tfrmoptionslog.cblogsuccess.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGSUCCESS.CAPTION"
|
|
msgid "Log &successful operations"
|
|
msgstr "Log de operações com &sucesso."
|
|
|
|
#: tfrmoptionslog.cblogvfs.caption
|
|
msgctxt "TFRMOPTIONSLOG.CBLOGVFS.CAPTION"
|
|
msgid "&File system plugins"
|
|
msgstr "Plugins do sistema de &arquivos."
|
|
|
|
#: tfrmoptionslog.gblogfile.caption
|
|
msgctxt "TFRMOPTIONSLOG.GBLOGFILE.CAPTION"
|
|
msgid "File operation log file"
|
|
msgstr "Arquivo de log de operações de arquivos."
|
|
|
|
#: tfrmoptionslog.gblogfileop.caption
|
|
msgid "Log operations"
|
|
msgstr "Log de operações."
|
|
|
|
#: tfrmoptionslog.gblogfilestatus.caption
|
|
msgid "Operation status"
|
|
msgstr "Estado da operação."
|
|
|
|
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
|
|
msgctxt "tfrmoptionsmisc.btnoutputpathfortoolbar.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
|
|
msgctxt "tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Algumas funções para selecionar o caminho apropriado "
|
|
|
|
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
|
|
msgctxt "tfrmoptionsmisc.btnrelativetcconfigfile.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Algumas funções para selecionar o caminho apropriado "
|
|
|
|
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
|
|
msgctxt "tfrmoptionsmisc.btnrelativetcexecutablefile.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Algumas funções para selecionar o caminho apropriado."
|
|
|
|
#: tfrmoptionsmisc.btnthumbcompactcache.caption
|
|
msgid "&Remove thumbnails for no longer existing files"
|
|
msgstr "&Remover miniaturas de arquivos que já não existem."
|
|
|
|
#: tfrmoptionsmisc.btnviewconfigfile.hint
|
|
msgctxt "tfrmoptionsmisc.btnviewconfigfile.hint"
|
|
msgid "View log file content"
|
|
msgstr "Ver conteúdo do arquivo de log."
|
|
|
|
#: tfrmoptionsmisc.chkdesccreateunicode.caption
|
|
msgid "Create new with the encoding:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.chkgotoroot.caption
|
|
msgid "Always &go to the root of a drive when changing drives"
|
|
msgstr "Ir sempre para a raíz da unidade ao mudar de unidades."
|
|
|
|
#: tfrmoptionsmisc.chkshowwarningmessages.caption
|
|
msgctxt "TFRMOPTIONSMISC.CHKSHOWWARNINGMESSAGES.CAPTION"
|
|
msgid "Show &warning messages (\"OK\" button only)"
|
|
msgstr "Mostrar mensagens de a&viso (Só botão \"OK\")."
|
|
|
|
#: tfrmoptionsmisc.chkthumbsave.caption
|
|
msgctxt "TFRMOPTIONSMISC.CHKTHUMBSAVE.CAPTION"
|
|
msgid "&Save thumbnails in cache"
|
|
msgstr "&Salvar miniaturas em memória."
|
|
|
|
#: tfrmoptionsmisc.dblthumbnails.caption
|
|
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
|
|
msgid "Thumbnails"
|
|
msgstr "Miniaturas"
|
|
|
|
#: tfrmoptionsmisc.gbfilecomments.caption
|
|
msgid "File comments (descript.ion)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.gbtcexportimport.caption
|
|
msgid "Regarding TC export/import:"
|
|
msgstr "Quanto à exportação / importação de TC:"
|
|
|
|
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
|
|
msgid "Default encoding:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmisc.lbltcconfig.caption
|
|
msgid "Configuration file:"
|
|
msgstr "Arquivo de configuração:"
|
|
|
|
#: tfrmoptionsmisc.lbltcexecutable.caption
|
|
msgid "TC executable:"
|
|
msgstr "TC executável:"
|
|
|
|
#: tfrmoptionsmisc.lbltcpathfortool.caption
|
|
msgid "Toolbar output path:"
|
|
msgstr "Caminho de saída da barra de ferramentas:"
|
|
|
|
#: tfrmoptionsmisc.lblthumbpixels.caption
|
|
msgid "pixels"
|
|
msgstr "pixels"
|
|
|
|
#: tfrmoptionsmisc.lblthumbseparator.caption
|
|
msgctxt "TFRMOPTIONSMISC.LBLTHUMBSEPARATOR.CAPTION"
|
|
msgid "X"
|
|
msgstr "X"
|
|
|
|
#: tfrmoptionsmisc.lblthumbsize.caption
|
|
msgid "&Thumbnail size:"
|
|
msgstr "&Tamanho da miniatura:"
|
|
|
|
#: tfrmoptionsmouse.cbselectionbymouse.caption
|
|
msgid "&Selection by mouse"
|
|
msgstr "&Seleção com o mouse."
|
|
|
|
#: tfrmoptionsmouse.chkmouseselectioniconclick.caption
|
|
msgid "By clic&king on icon"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsmouse.gbscrolling.caption
|
|
msgid "Scrolling"
|
|
msgstr "Deslocar"
|
|
|
|
#: tfrmoptionsmouse.gbselection.caption
|
|
msgid "Selection"
|
|
msgstr "Seleção"
|
|
|
|
#: tfrmoptionsmouse.lblmousemode.caption
|
|
msgid "&Mode:"
|
|
msgstr "&Modo:"
|
|
|
|
#: tfrmoptionsmouse.rbscrolllinebyline.caption
|
|
msgid "&Line by line"
|
|
msgstr "&Linha a linha:"
|
|
|
|
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
|
|
msgid "Line by line &with cursor movement"
|
|
msgstr "Linha a linha com movimento do cursor."
|
|
|
|
#: tfrmoptionsmouse.rbscrollpagebypage.caption
|
|
msgid "&Page by page"
|
|
msgstr "&Página a página."
|
|
|
|
#: tfrmoptionsplugins.btnaddplugin.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
|
|
msgid "A&dd"
|
|
msgstr "A&dicionar"
|
|
|
|
#: tfrmoptionsplugins.btnconfigplugin.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
|
|
msgid "Con&figure"
|
|
msgstr "Con&figurar"
|
|
|
|
#: tfrmoptionsplugins.btnenableplugin.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.BTNENABLEPLUGIN.CAPTION"
|
|
msgid "E&nable"
|
|
msgstr "A&tivar"
|
|
|
|
#: tfrmoptionsplugins.btnremoveplugin.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
|
|
msgid "&Remove"
|
|
msgstr "&Remover"
|
|
|
|
#: tfrmoptionsplugins.btntweakplugin.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.BTNTWEAKPLUGIN.CAPTION"
|
|
msgid "&Tweak"
|
|
msgstr "A&finar"
|
|
|
|
#: tfrmoptionsplugins.lbldsxdescription.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.LBLDSXDESCRIPTION.CAPTION"
|
|
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
|
|
msgstr "Suplementos de procura permitem usar algoritmos alternativos ou ferramentas externas (Como \"locate\", etc.)"
|
|
|
|
#: tfrmoptionsplugins.lblwcxdescription.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.LBLWCXDESCRIPTION.CAPTION"
|
|
msgid "Pack&er plugins are used to work with archives"
|
|
msgstr "Supl&ementos de compressão são usados para trabalhar com arquivos."
|
|
|
|
#: tfrmoptionsplugins.lblwdxdescription.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.LBLWDXDESCRIPTION.CAPTION"
|
|
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
|
|
msgstr "Suplementos de conteúdo permitem mostrar detalhes do arquivo, como etiquetas mp3 ou atributos de imagens na lista de arquivos ou usá-los nas ferramentas Procura e Multirenomear"
|
|
|
|
#: tfrmoptionsplugins.lblwfxdescription.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.LBLWFXDESCRIPTION.CAPTION"
|
|
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
|
|
msgstr "Suplementos do sistema de arquivos permitem o acesso a unidades inacessíveis pelo sistema operativo ou a dispositivos externos como o Palm/PocketPC."
|
|
|
|
#: tfrmoptionsplugins.lblwlxdescription.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.LBLWLXDESCRIPTION.CAPTION"
|
|
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
|
|
msgstr "Suplementos de &visualização permitem mostrar formatos de arquivos como imagens, folhas de cálculo, bases de dados, etc. no visualizador (F3, Ctrl+Q)"
|
|
|
|
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[0].TITLE.CAPTION"
|
|
msgid "Active"
|
|
msgstr "Ativo"
|
|
|
|
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
|
|
msgid "Plugin"
|
|
msgstr "Suplemento"
|
|
|
|
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[2].TITLE.CAPTION"
|
|
msgid "Registered for"
|
|
msgstr "Registado para"
|
|
|
|
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
|
|
msgid "File name"
|
|
msgstr "Nome de arquivo"
|
|
|
|
#: tfrmoptionsplugins.tsdsx.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.TSDSX.CAPTION"
|
|
msgid "&Search plugins (.DSX)"
|
|
msgstr "Suplementos de procura (.DSX)"
|
|
|
|
#: tfrmoptionsplugins.tswcx.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.TSWCX.CAPTION"
|
|
msgid "Pac&ker plugins (.WCX)"
|
|
msgstr "Suplementos de compressão (.WCX)"
|
|
|
|
#: tfrmoptionsplugins.tswdx.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.TSWDX.CAPTION"
|
|
msgid "Content pl&ugins (.WDX)"
|
|
msgstr "Suplementos de conteúdo (.WDX)"
|
|
|
|
#: tfrmoptionsplugins.tswfx.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.TSWFX.CAPTION"
|
|
msgid "F&ile system plugins (.WFX)"
|
|
msgstr "Suplementos do sistema de arquivos (.WFX)"
|
|
|
|
#: tfrmoptionsplugins.tswlx.caption
|
|
msgctxt "TFRMOPTIONSPLUGINS.TSWLX.CAPTION"
|
|
msgid "&Viewer plugins (.WLX)"
|
|
msgstr "Suplementos de visualização (.WLX)"
|
|
|
|
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
|
|
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTBEGINNING.CAPTION"
|
|
msgid "&Beginning (name must start with first typed character)"
|
|
msgstr "&Início (o nome tem de começar com o primeiro caracter digitado)."
|
|
|
|
#: tfrmoptionsquicksearchfilter.cbexactending.caption
|
|
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CBEXACTENDING.CAPTION"
|
|
msgid "En&ding (last character before a typed dot . must match)"
|
|
msgstr "Final (o último caracter antes do ponto tem de coinci&dir)."
|
|
|
|
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
|
|
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
|
|
msgid "Options"
|
|
msgstr "Opções"
|
|
|
|
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
|
|
msgid "Exact name match"
|
|
msgstr "Correspondência exata do nome."
|
|
|
|
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
|
|
msgid "Search case"
|
|
msgstr "Sensibilidade a maiúsculas."
|
|
|
|
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
|
|
msgid "Search for these items"
|
|
msgstr "Procurar por estes itens."
|
|
|
|
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
|
|
msgid "Keep renamed name when unlocking a tab"
|
|
msgstr "Manter nome renomeado quando desbloquando uma guia."
|
|
|
|
#: tfrmoptionstabs.cbtabsactivateonclick.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSACTIVATEONCLICK.CAPTION"
|
|
msgid "Activate target &panel when clicking on one of its Tabs"
|
|
msgstr "Ativar &painel destino ao clicar numa de suas Guias."
|
|
|
|
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSALWAYSVISIBLE.CAPTION"
|
|
msgid "&Show tab header also when there is only one tab"
|
|
msgstr "Mo&strar cabeçalho do guia mesmo que só haja uma."
|
|
|
|
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
|
|
msgid "Close duplicate tabs when closing application"
|
|
msgstr "Fechar guias duplicatas quando fechando aplicação."
|
|
|
|
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSCONFIRMCLOSEALL.CAPTION"
|
|
msgid "Con&firm close all tabs"
|
|
msgstr "Con&firma fechar todas as guias."
|
|
|
|
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
|
|
msgid "Confirm close locked tabs"
|
|
msgstr "Confirma fechar guias bloqueadas."
|
|
|
|
#: tfrmoptionstabs.cbtabslimitoption.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSLIMITOPTION.CAPTION"
|
|
msgid "&Limit tab title length to"
|
|
msgstr "&Limitar comprimento do título do guia a "
|
|
|
|
#: tfrmoptionstabs.cbtabslockedasterisk.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSLOCKEDASTERISK.CAPTION"
|
|
msgid "Show locked tabs &with an asterisk *"
|
|
msgstr "Mostrar guias blo&queados com um asterisco *"
|
|
|
|
#: tfrmoptionstabs.cbtabsmultilines.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSMULTILINES.CAPTION"
|
|
msgid "&Tabs on multiple lines"
|
|
msgstr "Guias em múl&tiplas linhas."
|
|
|
|
#: tfrmoptionstabs.cbtabsopenforeground.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSOPENFOREGROUND.CAPTION"
|
|
msgid "Ctrl+&Up opens new tab in foreground"
|
|
msgstr "Ctrl+&Up abre o novo guia em 1º plano."
|
|
|
|
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSOPENNEARCURRENT.CAPTION"
|
|
msgid "Open &new tabs near current tab"
|
|
msgstr "Abrir &novos guias ao lado do guia atual."
|
|
|
|
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
|
|
msgid "Reuse existing tab when possible"
|
|
msgstr "Reusar guia existente quando possível"
|
|
|
|
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
|
|
msgctxt "TFRMOPTIONSTABS.CBTABSSHOWCLOSEBUTTON.CAPTION"
|
|
msgid "Show ta&b close button"
|
|
msgstr "Mostrar &botão para fechar o guia."
|
|
|
|
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
|
|
msgid "Always show drive letter in tab title"
|
|
msgstr "Mostrar sempre a letra do drive no título da guia."
|
|
|
|
#: tfrmoptionstabs.gbtabs.caption
|
|
msgctxt "TFRMOPTIONSTABS.GBTABS.CAPTION"
|
|
msgid "Folder tabs headers"
|
|
msgstr "Cabeçalhos dos guias de pastas."
|
|
|
|
#: tfrmoptionstabs.lblchar.caption
|
|
msgctxt "TFRMOPTIONSTABS.LBLCHAR.CAPTION"
|
|
msgid "characters"
|
|
msgstr "caracteres."
|
|
|
|
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
|
|
msgid "Action to do when double click on a tab:"
|
|
msgstr "Ação a ser executada quando der dois cliques na guia."
|
|
|
|
#: tfrmoptionstabs.lbltabsposition.caption
|
|
msgctxt "TFRMOPTIONSTABS.LBLTABSPOSITION.CAPTION"
|
|
msgid "Ta&bs position"
|
|
msgstr "Posição dos s&eparadores"
|
|
|
|
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
|
|
msgctxt "tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text"
|
|
msgid "None"
|
|
msgstr "Nenhum"
|
|
|
|
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
|
|
msgctxt "tfrmoptionstabsextra.cbdefaultsavedirhistory.text"
|
|
msgid "No"
|
|
msgstr "Não"
|
|
|
|
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
|
|
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text"
|
|
msgid "Left"
|
|
msgstr "Esquerda"
|
|
|
|
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
|
|
msgctxt "tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text"
|
|
msgid "Right"
|
|
msgstr "Direita"
|
|
|
|
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
|
|
msgid "Goto to Favorite Tabs Configuration after resaving"
|
|
msgstr "Ir para a Configuração de Guias Favoritos depois de salvar."
|
|
|
|
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
|
|
msgid "Goto to Favorite Tabs Configuration after saving a new one"
|
|
msgstr "Ir para a Configuração de Guias Favoritos depois de salvar uma nova."
|
|
|
|
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
|
|
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
|
|
msgstr "Ativar as opções extras de Favoritos (selecione o lado de destino quando restaurar, etc.)."
|
|
|
|
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
|
|
msgid "Default extra settings when saving new Favorite Tabs:"
|
|
msgstr "Configurações extras padrão ao salvar novas guias favoritas:"
|
|
|
|
#: tfrmoptionstabsextra.gbtabs.caption
|
|
msgid "Folder tabs headers extra"
|
|
msgstr "Cabeçalho extra em guias de pastas."
|
|
|
|
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
|
|
msgid "When restoring tab, existing tabs to keep:"
|
|
msgstr "Ao restaurar a guia, manter as guias existentes:"
|
|
|
|
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
|
|
msgid "Tabs saved on left will be restored to:"
|
|
msgstr "Guias do lado esquerdo salvas, serão restauradas para:"
|
|
|
|
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
|
|
msgid "Tabs saved on right will be restored to:"
|
|
msgstr "Guias do lado direito salvas, serão restauradas para:"
|
|
|
|
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
|
|
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
|
|
msgid "Keep saving dir history with Favorite Tabs:"
|
|
msgstr "Manter salvo histórico de pasta com Guia Favoritos"
|
|
|
|
#: tfrmoptionstabsextra.rgwheretoadd.caption
|
|
msgid "Default position in menu when saving a new Favorite Tabs:"
|
|
msgstr "Posição default no menu quando salvando uma nova Guia Favoritos:"
|
|
|
|
#: tfrmoptionsterminal.edrunintermcloseparams.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.edrunintermcloseparams.hint"
|
|
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
|
msgstr "{command} deve normalmente estar presente aqui para refletir o comando a ser executado no terminal."
|
|
|
|
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.edrunintermstayopenparams.hint"
|
|
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
|
msgstr "{command} deve normalmente estar presente aqui para refletir o comando a ser executado no terminal."
|
|
|
|
#: tfrmoptionsterminal.edruntermparams.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.edruntermparams.hint"
|
|
msgid "{command} should normally be present here to reflect the command to be run in terminal"
|
|
msgstr "{command} deve normalmente estar presente aqui para refletir o comando a ser executado no terminal."
|
|
|
|
#: tfrmoptionsterminal.gbjustrunterminal.caption
|
|
msgid "Command for just running terminal:"
|
|
msgstr "Comando para executar somente no terminal:"
|
|
|
|
#: tfrmoptionsterminal.gbruninterminalclose.caption
|
|
msgid "Command for running a command in terminal and close after:"
|
|
msgstr "Comando para executar um comando no terminal e fechar após o comando:"
|
|
|
|
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
|
|
msgid "Command for running a command in terminal and stay open:"
|
|
msgstr "Comando para executar um comando no terminal e continuar aberto:"
|
|
|
|
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbrunintermclosecmd.caption"
|
|
msgid "Command:"
|
|
msgstr "Comando:"
|
|
|
|
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbrunintermcloseparams.caption"
|
|
msgid "Parameters:"
|
|
msgstr "Parâmetros"
|
|
|
|
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbrunintermstayopencmd.caption"
|
|
msgid "Command:"
|
|
msgstr "Comando:"
|
|
|
|
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbrunintermstayopenparams.caption"
|
|
msgid "Parameters:"
|
|
msgstr "Parâmetros:"
|
|
|
|
#: tfrmoptionsterminal.lbruntermcmd.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbruntermcmd.caption"
|
|
msgid "Command:"
|
|
msgstr "Comando:"
|
|
|
|
#: tfrmoptionsterminal.lbruntermparams.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionsterminal.lbruntermparams.caption"
|
|
msgid "Parameters:"
|
|
msgstr "Parâmetros"
|
|
|
|
#: tfrmoptionstoolbar.btnclonebutton.caption
|
|
msgid "C&lone button"
|
|
msgstr "C&lonar botão"
|
|
|
|
#: tfrmoptionstoolbar.btndeletebutton.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
|
|
msgid "&Delete"
|
|
msgstr "&Excluir"
|
|
|
|
#: tfrmoptionstoolbar.btnedithotkey.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.BTNEDITHOTKEY.CAPTION"
|
|
msgid "Edit hot&key"
|
|
msgstr "Editar atal&ho"
|
|
|
|
#: tfrmoptionstoolbar.btninsertbutton.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.BTNINSERTBUTTON.CAPTION"
|
|
msgid "&Insert new button"
|
|
msgstr "&Inserir novo botão"
|
|
|
|
#: tfrmoptionstoolbar.btnopencmddlg.caption
|
|
msgid "Select"
|
|
msgstr "Selecionar"
|
|
|
|
#: tfrmoptionstoolbar.btnopenfile.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstoolbar.btnother.caption
|
|
msgctxt "tfrmoptionstoolbar.btnother.caption"
|
|
msgid "Other..."
|
|
msgstr "Outro..."
|
|
|
|
#: tfrmoptionstoolbar.btnremovehotkey.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.BTNREMOVEHOTKEY.CAPTION"
|
|
msgid "Remove hotke&y"
|
|
msgstr "Remo&ver atalho"
|
|
|
|
#: tfrmoptionstoolbar.btnstartpath.caption
|
|
msgctxt "tfrmoptionstoolbar.btnstartpath.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
|
|
msgid "Suggest"
|
|
msgstr "Sugestão"
|
|
|
|
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
|
|
msgid "Have DC suggest the tooltip based on button type, command and parameters"
|
|
msgstr "O DC sugere a dica de ferramenta com base no tipo de botão, comando e parâmetros"
|
|
|
|
#: tfrmoptionstoolbar.cbflatbuttons.caption
|
|
msgctxt "tfrmoptionstoolbar.cbflatbuttons.caption"
|
|
msgid "&Flat buttons"
|
|
msgstr "Botões p&lanos."
|
|
|
|
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
|
|
msgid "Report errors with commands"
|
|
msgstr "Relatório de erros com comandos."
|
|
|
|
#: tfrmoptionstoolbar.edtinternalparameters.hint
|
|
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
|
|
msgstr "Introduzir parâmetros de comandos, cada um em sua linha. Prima F1 para ajuda dos parâmetros."
|
|
|
|
#: tfrmoptionstoolbar.gbgroupbox.caption
|
|
msgid "Appearance"
|
|
msgstr "Aparência"
|
|
|
|
#: tfrmoptionstoolbar.lblbarsize.caption
|
|
msgid "&Bar size:"
|
|
msgstr "Tamanho da &barra:"
|
|
|
|
#: tfrmoptionstoolbar.lblexternalcommand.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALCOMMAND.CAPTION"
|
|
msgid "Comman&d:"
|
|
msgstr "Coman&do:"
|
|
|
|
#: tfrmoptionstoolbar.lblexternalparameters.caption
|
|
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
|
|
msgid "Parameter&s:"
|
|
msgstr "Parâmetro&s:"
|
|
|
|
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
|
|
msgctxt "tfrmoptionstoolbar.lblhelponinternalcommand.caption"
|
|
msgid "Help"
|
|
msgstr "Ajuda"
|
|
|
|
#: tfrmoptionstoolbar.lblhotkey.caption
|
|
msgid "Hot key:"
|
|
msgstr "Atalho:"
|
|
|
|
#: tfrmoptionstoolbar.lbliconfile.caption
|
|
msgid "Ico&n:"
|
|
msgstr "Íco&ne:"
|
|
|
|
#: tfrmoptionstoolbar.lbliconsize.caption
|
|
msgid "Icon si&ze:"
|
|
msgstr "Tamanho do í&cone:"
|
|
|
|
#: tfrmoptionstoolbar.lblinternalcommand.caption
|
|
msgctxt "tfrmoptionstoolbar.lblinternalcommand.caption"
|
|
msgid "Co&mmand:"
|
|
msgstr "Co&mando:"
|
|
|
|
#: tfrmoptionstoolbar.lblinternalparameters.caption
|
|
msgctxt "tfrmoptionstoolbar.lblinternalparameters.caption"
|
|
msgid "&Parameters:"
|
|
msgstr "&Parâmetros:"
|
|
|
|
#: tfrmoptionstoolbar.lblstartpath.caption
|
|
msgctxt "tfrmoptionstoolbar.lblstartpath.caption"
|
|
msgid "Start pat&h:"
|
|
msgstr "Camin&ho inicial:"
|
|
|
|
#: tfrmoptionstoolbar.lbltooltip.caption
|
|
msgid "&Tooltip:"
|
|
msgstr "Su&gestão:"
|
|
|
|
#: tfrmoptionstoolbar.miaddallcmds.caption
|
|
msgid "Add toolbar with ALL DC commands"
|
|
msgstr "Adicionar barra de ferramentas com TODOS COMANDOS DC"
|
|
|
|
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
|
|
msgid "for an external command"
|
|
msgstr "por um comando externo"
|
|
|
|
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
|
|
msgid "for an internal command"
|
|
msgstr "por um comando interno"
|
|
|
|
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
|
|
msgid "for a separator"
|
|
msgstr "de uma guia"
|
|
|
|
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
|
|
msgid "for a sub-tool bar"
|
|
msgstr "de uma sub-barra de ferramenta"
|
|
|
|
#: tfrmoptionstoolbar.mibackup.caption
|
|
msgctxt "tfrmoptionstoolbar.mibackup.caption"
|
|
msgid "Backup..."
|
|
msgstr "Backup"
|
|
|
|
#: tfrmoptionstoolbar.miexport.caption
|
|
msgctxt "tfrmoptionstoolbar.miexport.caption"
|
|
msgid "Export..."
|
|
msgstr "Exportar..."
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrent.caption
|
|
msgid "Current toolbar..."
|
|
msgstr "Barra Ferramenta atual..."
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttodcbar.caption"
|
|
msgid "to a Toolbar File (.toolbar)"
|
|
msgstr "para um arquivo de barra de ferramenta (.toolbar)"
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption"
|
|
msgid "to a TC .BAR file (keep existing)"
|
|
msgstr "para um arquivo TC .BAR (manter o existente)"
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption"
|
|
msgid "to a TC .BAR file (erase existing)"
|
|
msgstr "para um arquivo TC .BAR (excluir o existente)"
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
|
msgstr "para um \"wincmd.ini\" do TC (manter o existente)"
|
|
|
|
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
|
msgstr "para um \"wincmd.ini\" do TC (excluir o existente)"
|
|
|
|
#: tfrmoptionstoolbar.miexportseparator1.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miexportseparator2.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportseparator2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miexportseparator3.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportseparator3.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miexportseparator4.caption
|
|
msgctxt "tfrmoptionstoolbar.miexportseparator4.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miexporttop.caption
|
|
msgid "Top toolbar..."
|
|
msgstr "Barra de Ferramenta no Topo..."
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptobackup.caption
|
|
msgid "Save a backup of Toolbar"
|
|
msgstr "Salvar um backup da Barra de Ferramentas"
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
|
|
msgid "to a Toolbar File (.toolbar)"
|
|
msgstr "para um arquivo de Barra de Ferramentas (.toolbar)"
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
|
|
msgid "to a TC .BAR file (keep existing)"
|
|
msgstr "para um arquivo TC .BAR (manter o existente)"
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
|
|
msgid "to a TC .BAR file (erase existing)"
|
|
msgstr "para um arquivo TC .BAR (excluir o existente)"
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptotcinikeep.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (keep existing)"
|
|
msgstr "para um \"wincmd.ini\" do TC (manter o existente)"
|
|
|
|
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
|
|
msgctxt "tfrmoptionstoolbar.miexporttoptotcininokeep.caption"
|
|
msgid "to a \"wincmd.ini\" of TC (erase existing)"
|
|
msgstr "para um \"wincmd.ini\" do TC (excluir o existente)"
|
|
|
|
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miexternalcommandaftercurrent.caption"
|
|
msgid "just after current selection"
|
|
msgstr "Logo após a seleção atual"
|
|
|
|
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miexternalcommandfirstelement.caption"
|
|
msgid "as first element"
|
|
msgstr "como primeiro elemento"
|
|
|
|
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miexternalcommandlastelement.caption"
|
|
msgid "as last element"
|
|
msgstr "como último elemento"
|
|
|
|
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption"
|
|
msgid "just prior current selection"
|
|
msgstr "Antes da seleção atual"
|
|
|
|
#: tfrmoptionstoolbar.miimport.caption
|
|
msgctxt "tfrmoptionstoolbar.miimport.caption"
|
|
msgid "Import..."
|
|
msgstr "Importar..."
|
|
|
|
#: tfrmoptionstoolbar.miimportbackup.caption
|
|
msgid "Restore a backup of Toolbar"
|
|
msgstr "Restaurar um backup da Barra de Ferramentas"
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupaddcurrent.caption"
|
|
msgid "to add to current toolbar"
|
|
msgstr "Adicionar na barra de ferramentas atual"
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption"
|
|
msgid "to add to a new toolbar to current toolbar"
|
|
msgstr "Adicionar uma nova barra de ferramentas à barra de ferramentas atual"
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupaddmenutop.caption"
|
|
msgid "to add to a new toolbar to top toolbar"
|
|
msgstr "Adicionar uma nova barra de ferramentas à barra de ferramentas superior"
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupaddtop.caption"
|
|
msgid "to add to top toolbar"
|
|
msgstr "Adicionar à barra de ferramentas superior"
|
|
|
|
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportbackupreplacetop.caption"
|
|
msgid "to replace top toolbar"
|
|
msgstr "Para substituir a barra de ferramentas superior"
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbar.caption
|
|
msgid "from a Toolbar File (.toolbar)"
|
|
msgstr "De um arquivo da barra de ferramentas (.toolbar)"
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
|
|
msgid "to add to current toolbar"
|
|
msgstr "Adicionar à barra de ferramentas atual"
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
|
|
msgid "to add to a new toolbar to current toolbar"
|
|
msgstr "Adicionar uma nova barra de ferramentas à barra de ferramentas atual"
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
|
|
msgid "to add to a new toolbar to top toolbar"
|
|
msgstr "Adicionar uma nova barra de ferramentas à barra de ferramentas superior"
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
|
|
msgid "to add to top toolbar"
|
|
msgstr "Adicionar à barra de ferramentas superior"
|
|
|
|
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
|
|
msgid "to replace top toolbar"
|
|
msgstr "Para substituir a barra de ferramentas superior"
|
|
|
|
#: tfrmoptionstoolbar.miimportseparator.caption
|
|
msgctxt "tfrmoptionstoolbar.miimportseparator.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbar.caption
|
|
msgid "from a single TC .BAR file"
|
|
msgstr "A partir de um único arquivo TC .BAR"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbaraddcurrent.caption"
|
|
msgid "to add to current toolbar"
|
|
msgstr "Adicionar à barra de ferramentas atual"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption"
|
|
msgid "to add to a new toolbar to current toolbar"
|
|
msgstr "Adicionar uma nova barra de ferramentas à barra de ferramentas atual"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbaraddmenutop.caption"
|
|
msgid "to add to a new toolbar to top toolbar"
|
|
msgstr "Adicionar uma nova barra de ferramentas à barra de ferramentas superior"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbaraddtop.caption"
|
|
msgid "to add to top toolbar"
|
|
msgstr "Adicionar à barra de ferramentas superior"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcbarreplacetop.caption"
|
|
msgid "to replace top toolbar"
|
|
msgstr "Para substituir a barra de ferramentas superior"
|
|
|
|
#: tfrmoptionstoolbar.miimporttcini.caption
|
|
msgid "from \"wincmd.ini\" of TC..."
|
|
msgstr "De \"wincmd.ini \" do TC ..."
|
|
|
|
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttciniaddcurrent.caption"
|
|
msgid "to add to current toolbar"
|
|
msgstr "Adicionar à barra de ferramentas atual."
|
|
|
|
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption"
|
|
msgid "to add to a new toolbar to current toolbar"
|
|
msgstr "Adicionar uma nova barra de ferramentas à barra de ferramentas atual."
|
|
|
|
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttciniaddmenutop.caption"
|
|
msgid "to add to a new toolbar to top toolbar"
|
|
msgstr "Adicionar uma nova barra de ferramentas à barra de ferramentas superior."
|
|
|
|
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttciniaddtop.caption"
|
|
msgid "to add to top toolbar"
|
|
msgstr "Adicionar à barra de ferramentas superior."
|
|
|
|
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
|
|
msgctxt "tfrmoptionstoolbar.miimporttcinireplacetop.caption"
|
|
msgid "to replace top toolbar"
|
|
msgstr "substituir a barra de ferramentas superior."
|
|
|
|
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miinternalcommandaftercurrent.caption"
|
|
msgid "just after current selection"
|
|
msgstr "logo após a seleção atual."
|
|
|
|
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miinternalcommandfirstelement.caption"
|
|
msgid "as first element"
|
|
msgstr "como primeiro elemento."
|
|
|
|
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miinternalcommandlastelement.caption"
|
|
msgid "as last element"
|
|
msgstr "como último elemento."
|
|
|
|
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption"
|
|
msgid "just prior current selection"
|
|
msgstr "antes da seleção atual."
|
|
|
|
#: tfrmoptionstoolbar.misearchandreplace.caption
|
|
msgctxt "tfrmoptionstoolbar.misearchandreplace.caption"
|
|
msgid "Search and replace..."
|
|
msgstr "Encontrar e substituir..."
|
|
|
|
#: tfrmoptionstoolbar.miseparator1.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator1.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator10.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator10.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator11.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator11.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator13.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator13.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator14.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator14.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator2.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator2.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator6.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator6.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator7.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator7.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator8.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator8.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparator9.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparator9.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
|
|
msgid "just after current selection"
|
|
msgstr "lgo após a seleção atual"
|
|
|
|
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
|
|
msgid "as first element"
|
|
msgstr "como primeiro elemento."
|
|
|
|
#: tfrmoptionstoolbar.miseparatorlastelement.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
|
|
msgid "as last element"
|
|
msgstr "como último elemento."
|
|
|
|
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
|
|
msgid "just prior current selection"
|
|
msgstr "após a seleção atual"
|
|
|
|
#: tfrmoptionstoolbar.misrcrplallofall.caption
|
|
msgid "in all of all the above..."
|
|
msgstr "em todos os acima ..."
|
|
|
|
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
|
|
msgctxt "tfrmoptionstoolbar.misrcrplclickseparator.caption"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmoptionstoolbar.misrcrplcommands.caption
|
|
msgid "in all commands..."
|
|
msgstr "em todos os comandos..."
|
|
|
|
#: tfrmoptionstoolbar.misrcrpliconnames.caption
|
|
msgid "in all icon names..."
|
|
msgstr "Em todos os nomes de ícones ..."
|
|
|
|
#: tfrmoptionstoolbar.misrcrplparameters.caption
|
|
msgid "in all parameters..."
|
|
msgstr "em todos parâmetros..."
|
|
|
|
#: tfrmoptionstoolbar.misrcrplstartpath.caption
|
|
msgid "in all start path..."
|
|
msgstr "em todos caminhos iniciais..."
|
|
|
|
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.misubtoolbaraftercurrent.caption"
|
|
msgid "just after current selection"
|
|
msgstr "logo após a seleção atual"
|
|
|
|
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
|
|
msgctxt "tfrmoptionstoolbar.misubtoolbarfirstelement.caption"
|
|
msgid "as first element"
|
|
msgstr "como primeiro elemento"
|
|
|
|
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
|
|
msgctxt "tfrmoptionstoolbar.misubtoolbarlastelement.caption"
|
|
msgid "as last element"
|
|
msgstr "como último elemento."
|
|
|
|
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
|
|
msgctxt "tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption"
|
|
msgid "just prior current selection"
|
|
msgstr "antes da seleção atual."
|
|
|
|
#: tfrmoptionstoolbar.rgtoolitemtype.caption
|
|
msgid "Button type"
|
|
msgstr "Tipo de botão:"
|
|
|
|
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
|
|
msgctxt "tfrmoptionstoolbase.btnrelativetoolpath.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Algumas funções para selecionar o caminho apropriado."
|
|
|
|
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
|
|
msgid "&Keep terminal window open after executing program"
|
|
msgstr "Manter a janela do terminal aberta após executar um programa."
|
|
|
|
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
|
|
msgid "&Execute in terminal"
|
|
msgstr "&Executar no terminal."
|
|
|
|
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
|
|
msgid "&Use external program"
|
|
msgstr "&Usar programa externo."
|
|
|
|
#: tfrmoptionstoolbase.lbltoolsparameters.caption
|
|
msgid "A&dditional parameters"
|
|
msgstr "Parâmetros a&dicionais."
|
|
|
|
#: tfrmoptionstoolbase.lbltoolspath.caption
|
|
msgid "&Path to program to execute"
|
|
msgstr "Caminho do &programa a executar."
|
|
|
|
#: tfrmoptionstooltips.btnaddfields.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
|
|
msgid "A&dd"
|
|
msgstr "A&dicionar"
|
|
|
|
#: tfrmoptionstooltips.btnapplyfields.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
|
|
msgid "A&pply"
|
|
msgstr "A&plicar"
|
|
|
|
#: tfrmoptionstooltips.btndeletefields.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
|
|
msgid "D&elete"
|
|
msgstr "&Excluir"
|
|
|
|
#: tfrmoptionstooltips.btnfieldslist.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
|
|
msgid "Template..."
|
|
msgstr "Modelo..."
|
|
|
|
#: tfrmoptionstooltips.chkshowtooltip.caption
|
|
msgctxt "tfrmoptionstooltips.chkshowtooltip.caption"
|
|
msgid "&Show tooltip for files in the file panel"
|
|
msgstr "&Mostrar dicas para arquivos no painel de arquivo."
|
|
|
|
#: tfrmoptionstooltips.gbcustomfields.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.GBCUSTOMFIELDS.CAPTION"
|
|
msgid "Custom fields by file type"
|
|
msgstr "Campos personalizados por tipo de arquivo."
|
|
|
|
#: tfrmoptionstooltips.lblfieldslist.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSLIST.CAPTION"
|
|
msgid "Category &hint:"
|
|
msgstr "Palpite da cate&goria:"
|
|
|
|
#: tfrmoptionstooltips.lblfieldsmask.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
|
|
msgid "Category &mask:"
|
|
msgstr "&Máscara da categoria:"
|
|
|
|
#: tfrmoptionstooltips.lblfieldsname.caption
|
|
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
|
|
msgid "Category &name:"
|
|
msgstr "&Nome da categoria:"
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
|
|
msgid "With double-click on the bar on top of a file panel"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
|
|
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
|
|
msgid "With the menu and internal command"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
|
|
msgid "Double click in tree select and exit"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
|
|
msgctxt "tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption"
|
|
msgid "With the menu and internal command"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
|
|
msgid "With double-click on a tab (if configured for it)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
|
|
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
|
|
msgid "Single mouse click in tree select and exit"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
|
|
msgid "Use it for Command Line History"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
|
|
msgid "Use it for the Dir History"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
|
|
msgid "Use it for the View History (Visited paths for active view)"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.gbbehavior.caption
|
|
msgid "Behavior regarding selection:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
|
|
msgid "Tree View Menus related options:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
|
|
msgid "Where to use Tree View Menus:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.lblnote.caption
|
|
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
|
|
msgid "With Directory Hotlist:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
|
|
msgid "With Favorite Tabs:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
|
|
msgid "With History:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btncursorcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
|
|
msgid "Use and display keyboard shortcut for choosing items"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
|
|
msgid "Layout and colors options:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
|
|
msgid "Background color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
|
|
msgid "Cursor color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
|
|
msgid "Found text color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
|
|
msgid "Found text under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
|
|
msgid "Normal text color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
|
|
msgid "Normal text under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
|
|
msgid "Tree View Menu Preview:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
|
|
msgid "Secondary text color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
|
|
msgid "Secondary text under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
|
|
msgid "Shortcut color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
|
|
msgid "Shortcut under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
|
|
msgid "Unselectable text color:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
|
|
msgid "Unselectable under cursor:"
|
|
msgstr ""
|
|
|
|
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
|
|
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
|
|
msgstr ""
|
|
|
|
#: tfrmoptionsviewer.btnbackviewercolor.caption
|
|
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsviewer.btnfontviewercolor.caption
|
|
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmoptionsviewer.gbviewerbookmode.caption
|
|
msgid "Viewer Book Mode"
|
|
msgstr "Visualização Modo Livro"
|
|
|
|
#: tfrmoptionsviewer.gbviewerexample.caption
|
|
msgctxt "TFRMOPTIONSVIEWER.GBVIEWEREXAMPLE.CAPTION"
|
|
msgid "Example"
|
|
msgstr "Exemplo:"
|
|
|
|
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
|
|
msgid "&Background color in book viewer"
|
|
msgstr "Cor de &fundo da visão livro."
|
|
|
|
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
|
|
msgid "&Font color in book viewer"
|
|
msgstr "Cor de te&xto do livro."
|
|
|
|
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
|
|
msgid "&Number of columns in book viewer"
|
|
msgstr "&Número colunas do livro"
|
|
|
|
#: tfrmpackdlg.btnconfig.caption
|
|
msgctxt "TFRMPACKDLG.BTNCONFIG.CAPTION"
|
|
msgid "Con&figure"
|
|
msgstr "Con&figurar"
|
|
|
|
#: tfrmpackdlg.caption
|
|
msgctxt "TFRMPACKDLG.CAPTION"
|
|
msgid "Pack files"
|
|
msgstr "Comprimir arquivos"
|
|
|
|
#: tfrmpackdlg.cbcreateseparatearchives.caption
|
|
msgid "C&reate separate archives, one per selected file/dir"
|
|
msgstr "Criar arquivos separados, um por cada arquivo/pasta selecionado"
|
|
|
|
#: tfrmpackdlg.cbcreatesfx.caption
|
|
msgid "Create self e&xtracting archive"
|
|
msgstr "Criar arquivo de extração automática"
|
|
|
|
#: tfrmpackdlg.cbencrypt.caption
|
|
msgid "Encr&ypt"
|
|
msgstr "Encr&iptar"
|
|
|
|
#: tfrmpackdlg.cbmovetoarchive.caption
|
|
msgid "Mo&ve to archive"
|
|
msgstr "Mo&ver para arquivo"
|
|
|
|
#: tfrmpackdlg.cbmultivolume.caption
|
|
msgid "&Multiple disk archive"
|
|
msgstr "Arquivo de discos &múltiplos"
|
|
|
|
#: tfrmpackdlg.cbotherplugins.caption
|
|
msgid "=>"
|
|
msgstr "=>"
|
|
|
|
#: tfrmpackdlg.cbputintarfirst.caption
|
|
msgid "P&ut in the TAR archive first"
|
|
msgstr "Pôr no arq&uivo TAR primeiro"
|
|
|
|
#: tfrmpackdlg.cbstoredir.caption
|
|
msgid "Also &pack path names (only recursed)"
|
|
msgstr "Com&primir também nomes de caminhos (só recursivo)"
|
|
|
|
#: tfrmpackdlg.lblprompt.caption
|
|
msgid "Pack file(s) to the file:"
|
|
msgstr "Comprimir arquivo(s) para o arquivo:"
|
|
|
|
#: tfrmpackdlg.rgpacker.caption
|
|
msgid "Packer"
|
|
msgstr "Compressor"
|
|
|
|
#: tfrmpackinfodlg.btnclose.caption
|
|
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Fechar"
|
|
|
|
#: tfrmpackinfodlg.btnunpackallandexec.caption
|
|
msgid "Unpack &all and execute"
|
|
msgstr "Descomprimir todos e execut&ar"
|
|
|
|
#: tfrmpackinfodlg.btnunpackandexec.caption
|
|
msgid "&Unpack and execute"
|
|
msgstr "Descomprimir e exec&utar"
|
|
|
|
#: tfrmpackinfodlg.caption
|
|
msgctxt "TFRMPACKINFODLG.CAPTION"
|
|
msgid "Properties of packed file"
|
|
msgstr "Propriedades do arquivo comprimido"
|
|
|
|
#: tfrmpackinfodlg.lblattributes.caption
|
|
msgid "Attributes:"
|
|
msgstr "Atributos:"
|
|
|
|
#: tfrmpackinfodlg.lblcompressionratio.caption
|
|
msgid "Compression ratio:"
|
|
msgstr "Taxa de compressão:"
|
|
|
|
#: tfrmpackinfodlg.lbldate.caption
|
|
msgid "Date:"
|
|
msgstr "Data:"
|
|
|
|
#: tfrmpackinfodlg.lblmethod.caption
|
|
msgid "Method:"
|
|
msgstr "Método:"
|
|
|
|
#: tfrmpackinfodlg.lbloriginalsize.caption
|
|
msgid "Original size:"
|
|
msgstr "Tamanho original:"
|
|
|
|
#: tfrmpackinfodlg.lblpackedfile.caption
|
|
msgid "File:"
|
|
msgstr "Arquivo:"
|
|
|
|
#: tfrmpackinfodlg.lblpackedsize.caption
|
|
msgid "Packed size:"
|
|
msgstr "Tamanho comprimido:"
|
|
|
|
#: tfrmpackinfodlg.lblpacker.caption
|
|
msgid "Packer:"
|
|
msgstr "Compressor:"
|
|
|
|
#: tfrmpackinfodlg.lbltime.caption
|
|
msgid "Time:"
|
|
msgstr "Hora:"
|
|
|
|
#: tfrmquicksearch.btncancel.caption
|
|
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
|
|
msgid "X"
|
|
msgstr "X"
|
|
|
|
#: tfrmquicksearch.btncancel.hint
|
|
msgid "Close filter panel"
|
|
msgstr "Fechar painel de filtragem"
|
|
|
|
#: tfrmquicksearch.edtsearch.hint
|
|
msgid "Enter text to search for or filter by"
|
|
msgstr "Introduza o texto de filtragem ou filtre por"
|
|
|
|
#: tfrmquicksearch.sbcasesensitive.caption
|
|
msgid "Aa"
|
|
msgstr "Aa"
|
|
|
|
#: tfrmquicksearch.sbcasesensitive.hint
|
|
msgid "Case Sensitive"
|
|
msgstr "Sensível a maiúsculas"
|
|
|
|
#: tfrmquicksearch.sbdirectories.caption
|
|
msgid "D"
|
|
msgstr "D"
|
|
|
|
#: tfrmquicksearch.sbdirectories.hint
|
|
msgctxt "tfrmquicksearch.sbdirectories.hint"
|
|
msgid "Directories"
|
|
msgstr "Pastas"
|
|
|
|
#: tfrmquicksearch.sbfiles.caption
|
|
msgid "F"
|
|
msgstr "F"
|
|
|
|
#: tfrmquicksearch.sbfiles.hint
|
|
msgctxt "tfrmquicksearch.sbfiles.hint"
|
|
msgid "Files"
|
|
msgstr "Arquivos"
|
|
|
|
#: tfrmquicksearch.sbmatchbeginning.caption
|
|
msgid "{"
|
|
msgstr "{"
|
|
|
|
#: tfrmquicksearch.sbmatchbeginning.hint
|
|
msgid "Match Beginning"
|
|
msgstr "Comparar início"
|
|
|
|
#: tfrmquicksearch.sbmatchending.caption
|
|
msgid "}"
|
|
msgstr "}"
|
|
|
|
#: tfrmquicksearch.sbmatchending.hint
|
|
msgid "Match Ending"
|
|
msgstr "Comparar final"
|
|
|
|
#: tfrmquicksearch.tglfilter.caption
|
|
msgctxt "TFRMQUICKSEARCH.TGLFILTER.CAPTION"
|
|
msgid "Filter"
|
|
msgstr "Filtro"
|
|
|
|
#: tfrmquicksearch.tglfilter.hint
|
|
msgid "Toggle between search or filter"
|
|
msgstr "Alternar entre localizar e procurar"
|
|
|
|
#: tfrmsearchplugin.btnadd.caption
|
|
msgid "&More rules"
|
|
msgstr "&Mais regras"
|
|
|
|
#: tfrmsearchplugin.btndelete.caption
|
|
msgid "L&ess rules"
|
|
msgstr "M&enos regras"
|
|
|
|
#: tfrmsearchplugin.chkuseplugins.caption
|
|
msgid "Use &content plugins, combine with:"
|
|
msgstr "Usar &pliugins de conteúdo: combina com:"
|
|
|
|
#: tfrmsearchplugin.headercontrol.sections[0].text
|
|
msgctxt "tfrmsearchplugin.headercontrol.sections[0].text"
|
|
msgid "Plugin"
|
|
msgstr "Suplemento"
|
|
|
|
#: tfrmsearchplugin.headercontrol.sections[1].text
|
|
msgid "Field"
|
|
msgstr "Campo"
|
|
|
|
#: tfrmsearchplugin.headercontrol.sections[2].text
|
|
msgid "Operator"
|
|
msgstr "Operador"
|
|
|
|
#: tfrmsearchplugin.headercontrol.sections[3].text
|
|
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
|
|
msgid "Value"
|
|
msgstr "Valor"
|
|
|
|
#: tfrmsearchplugin.rband.caption
|
|
#, fuzzy
|
|
#| msgid "&E (any match)"
|
|
msgid "&AND (all match)"
|
|
msgstr "&E (qualquer combinação)"
|
|
|
|
#: tfrmsearchplugin.rbor.caption
|
|
msgid "&OR (any match)"
|
|
msgstr "&OU (qualquer combinação)"
|
|
|
|
#: tfrmselecttextrange.btppanel.cancelbutton.caption
|
|
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
|
|
msgid "Cancel"
|
|
msgstr "Cancelar"
|
|
|
|
#: tfrmselecttextrange.btppanel.closebutton.caption
|
|
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
|
|
msgid "&Close"
|
|
msgstr "&Fechar"
|
|
|
|
#: tfrmselecttextrange.btppanel.helpbutton.caption
|
|
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
|
|
msgid "&Help"
|
|
msgstr "A&juda"
|
|
|
|
#: tfrmselecttextrange.btppanel.okbutton.caption
|
|
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmselecttextrange.lblselecttext.caption
|
|
msgid "&Select the characters to insert:"
|
|
msgstr "&Selecionar os caracteres a inserir:"
|
|
|
|
#: tfrmsetfileproperties.btncancel.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmsetfileproperties.btnok.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmsetfileproperties.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CAPTION"
|
|
msgid "Change attributes"
|
|
msgstr "Alterar atributos"
|
|
|
|
#: tfrmsetfileproperties.cbsgid.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
|
|
msgid "SGID"
|
|
msgstr "SGID"
|
|
|
|
#: tfrmsetfileproperties.cbsticky.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
|
|
msgid "Sticky"
|
|
msgstr "Espesso"
|
|
|
|
#: tfrmsetfileproperties.cbsuid.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
|
|
msgid "SUID"
|
|
msgstr "SUID"
|
|
|
|
#: tfrmsetfileproperties.chkarchive.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKARCHIVE.CAPTION"
|
|
msgid "Archive"
|
|
msgstr "Arquivo"
|
|
|
|
#: tfrmsetfileproperties.chkcreationtime.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKCREATIONTIME.CAPTION"
|
|
msgid "Created:"
|
|
msgstr "Criado:"
|
|
|
|
#: tfrmsetfileproperties.chkhidden.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKHIDDEN.CAPTION"
|
|
msgid "Hidden"
|
|
msgstr "Oculto"
|
|
|
|
#: tfrmsetfileproperties.chklastaccesstime.caption
|
|
msgid "Accessed:"
|
|
msgstr "Acessado:"
|
|
|
|
#: tfrmsetfileproperties.chklastwritetime.caption
|
|
msgid "Modified:"
|
|
msgstr "Modificado:"
|
|
|
|
#: tfrmsetfileproperties.chkreadonly.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKREADONLY.CAPTION"
|
|
msgid "Read only"
|
|
msgstr "Só de leitura"
|
|
|
|
#: tfrmsetfileproperties.chkrecursive.caption
|
|
msgid "Including subfolders"
|
|
msgstr "Incluindo subpastas"
|
|
|
|
#: tfrmsetfileproperties.chksystem.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.CHKSYSTEM.CAPTION"
|
|
msgid "System"
|
|
msgstr "Sistema"
|
|
|
|
#: tfrmsetfileproperties.gbtimesamp.caption
|
|
msgid "Timestamp properties"
|
|
msgstr "Propriedades de selo temporal"
|
|
|
|
#: tfrmsetfileproperties.gbunixattributes.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
|
|
msgid "Attributes"
|
|
msgstr "Atributos"
|
|
|
|
#: tfrmsetfileproperties.gbwinattributes.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
|
|
msgid "Attributes"
|
|
msgstr "Atributos"
|
|
|
|
#: tfrmsetfileproperties.lblattrbitsstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
|
|
msgid "Bits:"
|
|
msgstr "Bits:"
|
|
|
|
#: tfrmsetfileproperties.lblattrgroupstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
|
|
msgid "Group"
|
|
msgstr "Grupo"
|
|
|
|
#: tfrmsetfileproperties.lblattrinfo.caption
|
|
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
|
|
msgid "(gray field means unchanged value)"
|
|
msgstr "(campo cinzento significa valor inalterado)"
|
|
|
|
#: tfrmsetfileproperties.lblattrotherstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
|
|
msgid "Other"
|
|
msgstr "Outro"
|
|
|
|
#: tfrmsetfileproperties.lblattrownerstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
|
|
msgid "Owner"
|
|
msgstr "Proprietário"
|
|
|
|
#: tfrmsetfileproperties.lblattrtext.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
|
|
msgid "-----------"
|
|
msgstr "-----------"
|
|
|
|
#: tfrmsetfileproperties.lblattrtextstr.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
|
|
msgid "Text:"
|
|
msgstr "Texto:"
|
|
|
|
#: tfrmsetfileproperties.lblexec.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
|
|
msgid "Execute"
|
|
msgstr "Executar"
|
|
|
|
#: tfrmsetfileproperties.lblmodeinfo.caption
|
|
msgctxt "tfrmsetfileproperties.lblmodeinfo.caption"
|
|
msgid "(gray field means unchanged value)"
|
|
msgstr "(campo cinzento significa valor inalterado)"
|
|
|
|
#: tfrmsetfileproperties.lbloctal.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
|
|
msgid "Octal:"
|
|
msgstr "Octal:"
|
|
|
|
#: tfrmsetfileproperties.lblread.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
|
|
msgid "Read"
|
|
msgstr "Ler"
|
|
|
|
#: tfrmsetfileproperties.lblwrite.caption
|
|
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
|
|
msgid "Write"
|
|
msgstr "Escrever"
|
|
|
|
#: tfrmsplitter.btncancel.caption
|
|
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmsplitter.btnftchoice.caption
|
|
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
|
|
msgid "..."
|
|
msgstr "..."
|
|
|
|
#: tfrmsplitter.btnok.caption
|
|
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmsplitter.btnrelativeftchoice.hint
|
|
msgctxt "tfrmsplitter.btnrelativeftchoice.hint"
|
|
msgid "Some functions to select appropriate path"
|
|
msgstr "Algumas funções para selecionar caminho apropriado."
|
|
|
|
#: tfrmsplitter.caption
|
|
msgctxt "TFRMSPLITTER.CAPTION"
|
|
msgid "Splitter"
|
|
msgstr "Divisor"
|
|
|
|
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
|
|
msgid "Require a CRC32 verification file"
|
|
msgstr "Requer um verificação CRC32 de arquivo."
|
|
|
|
#: tfrmsplitter.cmbxsize.text
|
|
msgid "1457664B - 3.5\""
|
|
msgstr "1457664B - 3.5\""
|
|
|
|
#: tfrmsplitter.grbxfile.caption
|
|
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
|
|
msgid "File name"
|
|
msgstr "Nome de arquivo"
|
|
|
|
#: tfrmsplitter.grbxsize.caption
|
|
msgid "Size and number of parts"
|
|
msgstr "Tamanho e nº. de partes"
|
|
|
|
#: tfrmsplitter.lbdirtarget.caption
|
|
msgid "Directory &target"
|
|
msgstr "Pas&ta destino"
|
|
|
|
#: tfrmsplitter.lbfilesource.caption
|
|
msgid "File &source"
|
|
msgstr "arquivo &origem"
|
|
|
|
#: tfrmsplitter.lblnumberparts.caption
|
|
msgid "&Number of parts"
|
|
msgstr "&Número de partes"
|
|
|
|
#: tfrmsplitter.rbtnbyte.caption
|
|
msgid "&Bytes"
|
|
msgstr "&Bytes"
|
|
|
|
#: tfrmsplitter.rbtngigab.caption
|
|
msgctxt "TFRMSPLITTER.RBTNGIGAB.CAPTION"
|
|
msgid "&Gigabytes"
|
|
msgstr "&Gigabytes"
|
|
|
|
#: tfrmsplitter.rbtnkilob.caption
|
|
msgctxt "TFRMSPLITTER.RBTNKILOB.CAPTION"
|
|
msgid "&Kilobytes"
|
|
msgstr "&Kilobytes"
|
|
|
|
#: tfrmsplitter.rbtnmegab.caption
|
|
msgctxt "TFRMSPLITTER.RBTNMEGAB.CAPTION"
|
|
msgid "&Megabytes"
|
|
msgstr "&Megabytes"
|
|
|
|
#: tfrmstartingsplash.caption
|
|
msgctxt "tfrmstartingsplash.caption"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmstartingsplash.lblbuild.caption
|
|
msgctxt "tfrmstartingsplash.lblbuild.caption"
|
|
msgid "Build"
|
|
msgstr "Construção"
|
|
|
|
#: tfrmstartingsplash.lblfreepascalver.caption
|
|
msgctxt "tfrmstartingsplash.lblfreepascalver.caption"
|
|
msgid "Free Pascal"
|
|
msgstr "Free Pascal"
|
|
|
|
#: tfrmstartingsplash.lbllazarusver.caption
|
|
msgctxt "tfrmstartingsplash.lbllazarusver.caption"
|
|
msgid "Lazarus"
|
|
msgstr "Lazarus"
|
|
|
|
#: tfrmstartingsplash.lbloperatingsystem.caption
|
|
msgid "Operating System"
|
|
msgstr "Sistema Operacional"
|
|
|
|
#: tfrmstartingsplash.lblplatform.caption
|
|
msgid "Platform"
|
|
msgstr "Plataforma"
|
|
|
|
#: tfrmstartingsplash.lblrevision.caption
|
|
msgctxt "tfrmstartingsplash.lblrevision.caption"
|
|
msgid "Revision"
|
|
msgstr "Revisão"
|
|
|
|
#: tfrmstartingsplash.lbltitle.caption
|
|
msgctxt "tfrmstartingsplash.lbltitle.caption"
|
|
msgid "Double Commander"
|
|
msgstr "Double Commander"
|
|
|
|
#: tfrmstartingsplash.lblversion.caption
|
|
msgctxt "tfrmstartingsplash.lblversion.caption"
|
|
msgid "Version"
|
|
msgstr "Versão"
|
|
|
|
#: tfrmstartingsplash.lblwidgetsetver.caption
|
|
msgid "WidgetsetVer"
|
|
msgstr "WidgetsetVer"
|
|
|
|
#: tfrmsymlink.btncancel.caption
|
|
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmsymlink.btnok.caption
|
|
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmsymlink.caption
|
|
msgid "Create symbolic link"
|
|
msgstr "Criar ligação simbólica"
|
|
|
|
#: tfrmsymlink.chkuserelativepath.caption
|
|
msgid "Use &relative path when possible"
|
|
msgstr ""
|
|
|
|
#: tfrmsymlink.lblexistingfile.caption
|
|
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
|
|
msgid "&Destination that the link will point to"
|
|
msgstr "&Destino para o qual a ligação aponta"
|
|
|
|
#: tfrmsymlink.lbllinktocreate.caption
|
|
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
|
|
msgid "&Link name"
|
|
msgstr "Nome da &ligação"
|
|
|
|
#: tfrmsyncdirsdlg.actselectclear.caption
|
|
msgid "Remove selection"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.actselectcopydefault.caption
|
|
msgid "Select for copying (default direction)"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.actselectcopylefttoright.caption
|
|
msgid "Select for copying -> (left to right)"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.actselectcopyreverse.caption
|
|
msgid "Reverse copy direction"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.actselectcopyrighttoleft.caption
|
|
msgid "Select for copying <- (right to left)"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.actselectdeleteright.caption
|
|
msgid "Select for deleting -> (right)"
|
|
msgstr ""
|
|
|
|
#: tfrmsyncdirsdlg.btnclose.caption
|
|
msgctxt "tfrmsyncdirsdlg.btnclose.caption"
|
|
msgid "Close"
|
|
msgstr "Fechar"
|
|
|
|
#: tfrmsyncdirsdlg.btncompare.caption
|
|
msgctxt "tfrmsyncdirsdlg.btncompare.caption"
|
|
msgid "Compare"
|
|
msgstr "Comparar"
|
|
|
|
#: tfrmsyncdirsdlg.btnseldir1.caption
|
|
msgctxt "tfrmsyncdirsdlg.btnseldir1.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmsyncdirsdlg.btnseldir2.caption
|
|
msgctxt "tfrmsyncdirsdlg.btnseldir2.caption"
|
|
msgid ">>"
|
|
msgstr ">>"
|
|
|
|
#: tfrmsyncdirsdlg.btnsynchronize.caption
|
|
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
|
|
msgid "Synchronize"
|
|
msgstr "Sincronizar"
|
|
|
|
#: tfrmsyncdirsdlg.caption
|
|
msgid "Synchronize directories"
|
|
msgstr "Sincronizar pastas"
|
|
|
|
#: tfrmsyncdirsdlg.cbextfilter.text
|
|
msgctxt "tfrmsyncdirsdlg.cbextfilter.text"
|
|
msgid "*.*"
|
|
msgstr "*.*"
|
|
|
|
#: tfrmsyncdirsdlg.chkasymmetric.caption
|
|
msgid "asymmetric"
|
|
msgstr "assimétrico"
|
|
|
|
#: tfrmsyncdirsdlg.chkbycontent.caption
|
|
msgid "by content"
|
|
msgstr "por conteúdo"
|
|
|
|
#: tfrmsyncdirsdlg.chkignoredate.caption
|
|
msgid "ignore date"
|
|
msgstr "ignorar data"
|
|
|
|
#: tfrmsyncdirsdlg.chkonlyselected.caption
|
|
msgid "only selected"
|
|
msgstr "somente selecionado"
|
|
|
|
#: tfrmsyncdirsdlg.chksubdirs.caption
|
|
msgid "Subdirs"
|
|
msgstr "Subpastas"
|
|
|
|
#: tfrmsyncdirsdlg.groupbox1.caption
|
|
msgid "Show:"
|
|
msgstr "Mostrar:"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[0].title.caption"
|
|
msgid "Name"
|
|
msgstr "Nome"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[1].title.caption"
|
|
msgid "Size"
|
|
msgstr "Tamanho"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[2].title.caption"
|
|
msgid "Date"
|
|
msgstr "Data"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
|
|
msgid "<=>"
|
|
msgstr "<=>"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[4].title.caption"
|
|
msgid "Date"
|
|
msgstr "Data"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[5].title.caption"
|
|
msgid "Size"
|
|
msgstr "Tamanho"
|
|
|
|
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
|
|
msgctxt "tfrmsyncdirsdlg.headerdg.columns[6].title.caption"
|
|
msgid "Name"
|
|
msgstr "Nome"
|
|
|
|
#: tfrmsyncdirsdlg.label1.caption
|
|
msgid "(in main window)"
|
|
msgstr "(na janela principal)"
|
|
|
|
#: tfrmsyncdirsdlg.menuitemcompare.caption
|
|
msgctxt "tfrmsyncdirsdlg.menuitemcompare.caption"
|
|
msgid "Compare"
|
|
msgstr "Comparar"
|
|
|
|
#: tfrmsyncdirsdlg.menuitemviewleft.caption
|
|
msgid "View left"
|
|
msgstr "Visão esquerda"
|
|
|
|
#: tfrmsyncdirsdlg.menuitemviewright.caption
|
|
msgid "View right"
|
|
msgstr "Visão direita"
|
|
|
|
#: tfrmsyncdirsdlg.sbcopyleft.caption
|
|
msgctxt "tfrmsyncdirsdlg.sbcopyleft.caption"
|
|
msgid "<"
|
|
msgstr "<"
|
|
|
|
#: tfrmsyncdirsdlg.sbcopyright.caption
|
|
msgctxt "tfrmsyncdirsdlg.sbcopyright.caption"
|
|
msgid ">"
|
|
msgstr ">"
|
|
|
|
#: tfrmsyncdirsdlg.sbduplicates.caption
|
|
msgid "duplicates"
|
|
msgstr "duplicatas"
|
|
|
|
#: tfrmsyncdirsdlg.sbequal.caption
|
|
msgid "="
|
|
msgstr "="
|
|
|
|
#: tfrmsyncdirsdlg.sbnotequal.caption
|
|
msgid "!="
|
|
msgstr "!="
|
|
|
|
#: tfrmsyncdirsdlg.sbsingles.caption
|
|
msgid "singles"
|
|
msgstr "simples"
|
|
|
|
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
|
|
msgid "Please press \"Compare\" to start"
|
|
msgstr "Favor pressionar \"Comparar\" para iniciar"
|
|
|
|
#: tfrmsyncdirsperformdlg.caption
|
|
msgctxt "tfrmsyncdirsperformdlg.caption"
|
|
msgid "Synchronize"
|
|
msgstr "Sincronizar"
|
|
|
|
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
|
|
msgid "Confirm overwrites"
|
|
msgstr "Confirmar substituições"
|
|
|
|
#: tfrmtreeviewmenu.caption
|
|
msgctxt "tfrmtreeviewmenu.caption"
|
|
msgid "Tree View Menu"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.lblsearchingentry.caption
|
|
msgid "Select your hot directory:"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmicasesensitive.caption
|
|
msgid "Search is case sensitive"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmifullcollapse.caption
|
|
msgid "Full collapse"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmifullexpand.caption
|
|
msgid "Full expand"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmiignoreaccents.caption
|
|
msgid "Search ignore accents and ligatures"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pminotcasesensitive.caption
|
|
msgid "Search is not case sensitive"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pminotignoreaccents.caption
|
|
msgid "Search is strict regarding accents and ligatures"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
|
|
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
|
|
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.tbcancelandquit.hint
|
|
msgid "Close Tree View Menu"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
|
|
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint"
|
|
msgid "Configuration of Tree View Menu"
|
|
msgstr ""
|
|
|
|
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
|
|
msgctxt "tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint"
|
|
msgid "Configuration of Tree View Menu Colors"
|
|
msgstr ""
|
|
|
|
#: tfrmtweakplugin.btnadd.caption
|
|
msgid "A&dd new"
|
|
msgstr "A&dicionar novo"
|
|
|
|
#: tfrmtweakplugin.btncancel.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: tfrmtweakplugin.btnchange.caption
|
|
msgid "C&hange"
|
|
msgstr "Al&terar"
|
|
|
|
#: tfrmtweakplugin.btndefault.caption
|
|
msgid "De&fault"
|
|
msgstr "Prede&finição"
|
|
|
|
#: tfrmtweakplugin.btnok.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: tfrmtweakplugin.btnremove.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
|
|
msgid "&Remove"
|
|
msgstr "&Remover"
|
|
|
|
#: tfrmtweakplugin.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.CAPTION"
|
|
msgid "Tweak plugin"
|
|
msgstr "Suplemento de afinação"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_by_content.caption
|
|
msgid "De&tect archive type by content"
|
|
msgstr "De&tetar tipo de arquivo por conteúdo"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_delete.caption
|
|
msgid "Can de&lete files"
|
|
msgstr "Pode Excluir Ar&quivos"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
|
|
msgid "Supports e&ncryption"
|
|
msgstr "Suporta e&ncriptação"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_hide.caption
|
|
msgid "Sho&w as normal files (hide packer icon)"
|
|
msgstr "Mo&strar como arquivos normais (ocultar ícone do compressor)"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_mempack.caption
|
|
msgid "Supports pac&king in memory"
|
|
msgstr "Suporta co&mpressão em memória"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_modify.caption
|
|
msgid "Can &modify existing archives"
|
|
msgstr "Pode modificar arquivos existentes"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_multiple.caption
|
|
msgid "&Archive can contain multiple files"
|
|
msgstr "O &arquivo pode conter múltiplos arquivos"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_new.caption
|
|
msgid "Can create new archi&ves"
|
|
msgstr "Pode criar novos arqui&vos"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_options.caption
|
|
msgid "S&upports the options dialogbox"
|
|
msgstr "S&uporta diálogo de opções"
|
|
|
|
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
|
|
msgid "Allow searchin&g for text in archives"
|
|
msgstr "Permitir procurar texto nos ar&quivos"
|
|
|
|
#: tfrmtweakplugin.lbldescription.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLDESCRIPTION.CAPTION"
|
|
msgid "&Description:"
|
|
msgstr "&Descrição:"
|
|
|
|
#: tfrmtweakplugin.lbldetectstr.caption
|
|
msgid "D&etect string:"
|
|
msgstr "D&etetar cadeia:"
|
|
|
|
#: tfrmtweakplugin.lblextension.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLEXTENSION.CAPTION"
|
|
msgid "&Extension:"
|
|
msgstr "&Extensão:"
|
|
|
|
#: tfrmtweakplugin.lblflags.caption
|
|
msgid "Flags:"
|
|
msgstr "Bandeiras:"
|
|
|
|
#: tfrmtweakplugin.lblname.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLNAME.CAPTION"
|
|
msgid "&Name:"
|
|
msgstr "&Nome:"
|
|
|
|
#: tfrmtweakplugin.lblplugin.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN.CAPTION"
|
|
msgid "&Plugin:"
|
|
msgstr "Su&plemento:"
|
|
|
|
#: tfrmtweakplugin.lblplugin1.caption
|
|
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
|
|
msgid "&Plugin:"
|
|
msgstr "Su&plemento:"
|
|
|
|
#: tfrmviewer.actabout.caption
|
|
msgctxt "TFRMVIEWER.ACTABOUT.CAPTION"
|
|
msgid "About Viewer..."
|
|
msgstr "Sobre o visualizador..."
|
|
|
|
#: tfrmviewer.actabout.hint
|
|
msgid "Displays the About message"
|
|
msgstr "Mostra a mensagem Sobre"
|
|
|
|
#: tfrmviewer.actchangeencoding.caption
|
|
msgid "Change encoding"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actcopyfile.caption
|
|
msgctxt "TFRMVIEWER.ACTCOPYFILE.CAPTION"
|
|
msgid "Copy File"
|
|
msgstr "Copiar arquivo"
|
|
|
|
#: tfrmviewer.actcopyfile.hint
|
|
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
|
|
msgid "Copy File"
|
|
msgstr "Copiar arquivo"
|
|
|
|
#: tfrmviewer.actcopytoclipboard.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actcopytoclipboard.caption"
|
|
msgid "Copy To Clipboard"
|
|
msgstr "Copiar para a área de transferência"
|
|
|
|
#: tfrmviewer.actcopytoclipboardformatted.caption
|
|
msgid "Copy To Clipboard Formatted"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actdeletefile.caption
|
|
msgctxt "TFRMVIEWER.ACTDELETEFILE.CAPTION"
|
|
msgid "Delete File"
|
|
msgstr "Excluir arquivo"
|
|
|
|
#: tfrmviewer.actdeletefile.hint
|
|
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
|
|
msgid "Delete File"
|
|
msgstr "Excluir arquivo"
|
|
|
|
#: tfrmviewer.actexitviewer.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actexitviewer.caption"
|
|
msgid "E&xit"
|
|
msgstr "&Sair"
|
|
|
|
#: tfrmviewer.actfind.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actfind.caption"
|
|
msgid "Find"
|
|
msgstr "Localizar"
|
|
|
|
#: tfrmviewer.actfindnext.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actfindnext.caption"
|
|
msgid "Find next"
|
|
msgstr "Localizar próxim"
|
|
|
|
#: tfrmviewer.actfindprev.caption
|
|
msgctxt "tfrmviewer.actfindprev.caption"
|
|
msgid "Find previous"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actfullscreen.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actfullscreen.caption"
|
|
msgid "Full Screen"
|
|
msgstr "Tela Cheia"
|
|
|
|
#: tfrmviewer.actimagecenter.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actimagecenter.caption"
|
|
msgid "Center"
|
|
msgstr "Centro"
|
|
|
|
#: tfrmviewer.actloadnextfile.caption
|
|
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.CAPTION"
|
|
msgid "&Next"
|
|
msgstr "Se&guinte"
|
|
|
|
#: tfrmviewer.actloadnextfile.hint
|
|
msgctxt "TFRMVIEWER.ACTLOADNEXTFILE.HINT"
|
|
msgid "Load Next File"
|
|
msgstr "Carregar o arquivo seguinte"
|
|
|
|
#: tfrmviewer.actloadprevfile.caption
|
|
msgctxt "TFRMVIEWER.ACTLOADPREVFILE.CAPTION"
|
|
msgid "&Previous"
|
|
msgstr "A&nterior"
|
|
|
|
#: tfrmviewer.actloadprevfile.hint
|
|
msgid "Load Previous File"
|
|
msgstr "Carregar o arquivo anterior"
|
|
|
|
#: tfrmviewer.actmirrorhorz.caption
|
|
msgid "Mirror Horizontally"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actmirrorhorz.hint
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actmirrorhorz.hint"
|
|
msgid "Mirror"
|
|
msgstr "Espelho"
|
|
|
|
#: tfrmviewer.actmirrorvert.caption
|
|
msgid "Mirror Vertically"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actmovefile.caption
|
|
msgctxt "TFRMVIEWER.ACTMOVEFILE.CAPTION"
|
|
msgid "Move File"
|
|
msgstr "Mover arquivo"
|
|
|
|
#: tfrmviewer.actmovefile.hint
|
|
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
|
|
msgid "Move File"
|
|
msgstr "Mover arquivo"
|
|
|
|
#: tfrmviewer.actpreview.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actpreview.caption"
|
|
msgid "Preview"
|
|
msgstr "Pré-visualizar"
|
|
|
|
#: tfrmviewer.actreload.caption
|
|
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
|
|
msgid "Reload"
|
|
msgstr "Recarregar"
|
|
|
|
#: tfrmviewer.actreload.hint
|
|
msgid "Reload current file"
|
|
msgstr "Recarregar o arquivo atual"
|
|
|
|
#: tfrmviewer.actrotate180.caption
|
|
#, fuzzy
|
|
#| msgid "Rotate 180"
|
|
msgctxt "TFRMVIEWER.ACTROTATE180.CAPTION"
|
|
msgid "+ 180"
|
|
msgstr "Girar 180º"
|
|
|
|
#: tfrmviewer.actrotate180.hint
|
|
#, fuzzy
|
|
#| msgid "Rotate 180"
|
|
msgctxt "TFRMVIEWER.ACTROTATE180.HINT"
|
|
msgid "Rotate 180 degrees"
|
|
msgstr "Girar 180º"
|
|
|
|
#: tfrmviewer.actrotate270.caption
|
|
#, fuzzy
|
|
#| msgid "Rotate 270"
|
|
msgctxt "TFRMVIEWER.ACTROTATE270.CAPTION"
|
|
msgid "- 90"
|
|
msgstr "Girar 270º"
|
|
|
|
#: tfrmviewer.actrotate270.hint
|
|
#, fuzzy
|
|
#| msgid "Rotate 270"
|
|
msgctxt "TFRMVIEWER.ACTROTATE270.HINT"
|
|
msgid "Rotate -90 degrees"
|
|
msgstr "Girar 270º"
|
|
|
|
#: tfrmviewer.actrotate90.caption
|
|
#, fuzzy
|
|
#| msgid "Rotate 90"
|
|
msgctxt "TFRMVIEWER.ACTROTATE90.CAPTION"
|
|
msgid "+ 90"
|
|
msgstr "Girar 90º"
|
|
|
|
#: tfrmviewer.actrotate90.hint
|
|
#, fuzzy
|
|
#| msgid "Rotate 90"
|
|
msgctxt "TFRMVIEWER.ACTROTATE90.HINT"
|
|
msgid "Rotate +90 degrees"
|
|
msgstr "Girar 90º"
|
|
|
|
#: tfrmviewer.actsave.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actsave.caption"
|
|
msgid "Save"
|
|
msgstr "Salvar"
|
|
|
|
#: tfrmviewer.actsaveas.caption
|
|
msgctxt "TFRMVIEWER.ACTSAVEAS.CAPTION"
|
|
msgid "Save As..."
|
|
msgstr "Salvar como..."
|
|
|
|
#: tfrmviewer.actsaveas.hint
|
|
msgid "Save File As..."
|
|
msgstr "Salvar arquivo como..."
|
|
|
|
#: tfrmviewer.actscreenshot.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actscreenshot.caption"
|
|
msgid "Screenshot"
|
|
msgstr "Captura de ecrã"
|
|
|
|
#: tfrmviewer.actscreenshotdelay3sec.caption
|
|
msgid "Delay 3 sec"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actscreenshotdelay5sec.caption
|
|
msgid "Delay 5 sec"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actselectall.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actselectall.caption"
|
|
msgid "Select All"
|
|
msgstr "Selecionar tudo"
|
|
|
|
#: tfrmviewer.actshowasbin.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowasbin.caption"
|
|
msgid "Show as &Bin"
|
|
msgstr "Mostrar com &binário"
|
|
|
|
#: tfrmviewer.actshowasbook.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowasbook.caption"
|
|
msgid "Show as B&ook"
|
|
msgstr "Mostrar como &livro"
|
|
|
|
#: tfrmviewer.actshowasdec.caption
|
|
msgid "Show as &Dec"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actshowashex.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowashex.caption"
|
|
msgid "Show as &Hex"
|
|
msgstr "Mostrar com &hexadecimal"
|
|
|
|
#: tfrmviewer.actshowastext.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowastext.caption"
|
|
msgid "Show as &Text"
|
|
msgstr "Mostrar como &texto"
|
|
|
|
#: tfrmviewer.actshowaswraptext.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowaswraptext.caption"
|
|
msgid "Show as &Wrap text"
|
|
msgstr "Mostrar como texto aj&ustado"
|
|
|
|
#: tfrmviewer.actshowgraphics.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowgraphics.caption"
|
|
msgid "Graphics"
|
|
msgstr "Gráficos"
|
|
|
|
#: tfrmviewer.actshowplugins.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actshowplugins.caption"
|
|
msgid "Plugins"
|
|
msgstr "Suplementos"
|
|
|
|
#: tfrmviewer.actstretchimage.caption
|
|
msgctxt "TFRMVIEWER.ACTSTRETCHIMAGE.CAPTION"
|
|
msgid "Stretch"
|
|
msgstr "Esticar"
|
|
|
|
#: tfrmviewer.actstretchimage.hint
|
|
msgid "Stretch Image"
|
|
msgstr "Esticar a imagem"
|
|
|
|
#: tfrmviewer.actstretchonlylarge.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actstretchonlylarge.caption"
|
|
msgid "Stretch only large"
|
|
msgstr "Esticar apenas grande."
|
|
|
|
#: tfrmviewer.actzoom.caption
|
|
msgid "Zoom"
|
|
msgstr ""
|
|
|
|
#: tfrmviewer.actzoomin.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actzoomin.caption"
|
|
msgid "Zoom In"
|
|
msgstr "Ampliar"
|
|
|
|
#: tfrmviewer.actzoomout.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewer.actzoomout.caption"
|
|
msgid "Zoom Out"
|
|
msgstr "Reduzir"
|
|
|
|
#: tfrmviewer.btncopyfile.hint
|
|
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
|
|
msgid "Copy"
|
|
msgstr "Copiar"
|
|
|
|
#: tfrmviewer.btncopyfile1.hint
|
|
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
|
|
msgid "Copy"
|
|
msgstr "Copiar"
|
|
|
|
#: tfrmviewer.btncuttuimage.hint
|
|
msgctxt "TFRMVIEWER.BTNCUTTUIMAGE.HINT"
|
|
msgid "Crop"
|
|
msgstr "Cortar"
|
|
|
|
#: tfrmviewer.btndeletefile.hint
|
|
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
|
|
msgid "Delete"
|
|
msgstr "Excluir"
|
|
|
|
#: tfrmviewer.btndeletefile1.hint
|
|
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
|
|
msgid "Delete"
|
|
msgstr "Excluir"
|
|
|
|
#: tfrmviewer.btnfullscreen.hint
|
|
msgctxt "TFRMVIEWER.BTNFULLSCREEN.HINT"
|
|
msgid "Full Screen"
|
|
msgstr "Ecrã completo"
|
|
|
|
#: tfrmviewer.btngifmove.caption
|
|
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
|
|
msgid "||"
|
|
msgstr "||"
|
|
|
|
#: tfrmviewer.btngiftobmp.caption
|
|
msgid "S"
|
|
msgstr "S"
|
|
|
|
#: tfrmviewer.btnhightlight.hint
|
|
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
|
|
msgid "Highlight"
|
|
msgstr "Realçar"
|
|
|
|
#: tfrmviewer.btnmovefile.hint
|
|
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
|
|
msgid "Move"
|
|
msgstr "Mover"
|
|
|
|
#: tfrmviewer.btnmovefile1.hint
|
|
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
|
|
msgid "Move"
|
|
msgstr "Mover"
|
|
|
|
#: tfrmviewer.btnnextgifframe.caption
|
|
msgid "||>"
|
|
msgstr "||>"
|
|
|
|
#: tfrmviewer.btnpaint.hint
|
|
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
|
|
msgid "Paint"
|
|
msgstr "Pintar"
|
|
|
|
#: tfrmviewer.btnprevgifframe.caption
|
|
msgid "<||"
|
|
msgstr "<||"
|
|
|
|
#: tfrmviewer.btnredeye.hint
|
|
msgid "Red Eyes"
|
|
msgstr "Olhos vermelhos"
|
|
|
|
#: tfrmviewer.btnresize.hint
|
|
msgctxt "TFRMVIEWER.BTNRESIZE.HINT"
|
|
msgid "Resize"
|
|
msgstr "Redimensionar"
|
|
|
|
#: tfrmviewer.btnundo.hint
|
|
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
|
|
msgid "Undo"
|
|
msgstr "Desfazer"
|
|
|
|
#: tfrmviewer.caption
|
|
msgctxt "TFRMVIEWER.CAPTION"
|
|
msgid "Viewer"
|
|
msgstr "Visualizador"
|
|
|
|
#: tfrmviewer.cbslideshow.caption
|
|
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
|
|
msgid "Slide Show"
|
|
msgstr "Diaporama"
|
|
|
|
#: tfrmviewer.comboboxpaint.text
|
|
msgid "Pen"
|
|
msgstr "Caneta"
|
|
|
|
#: tfrmviewer.comboboxwidth.text
|
|
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
|
|
msgid "1"
|
|
msgstr "1"
|
|
|
|
#: tfrmviewer.gboxhightlight.caption
|
|
msgctxt "TFRMVIEWER.GBOXHIGHTLIGHT.CAPTION"
|
|
msgid "Highlight"
|
|
msgstr "Realçar"
|
|
|
|
#: tfrmviewer.gboxpaint.caption
|
|
msgctxt "TFRMVIEWER.GBOXPAINT.CAPTION"
|
|
msgid "Paint"
|
|
msgstr "Pintar"
|
|
|
|
#: tfrmviewer.gboxslideshow.caption
|
|
msgctxt "TFRMVIEWER.GBOXSLIDESHOW.CAPTION"
|
|
msgid "Slide Show"
|
|
msgstr "Show de Slides"
|
|
|
|
#: tfrmviewer.gboxview.caption
|
|
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
|
|
msgid "View"
|
|
msgstr "Ver"
|
|
|
|
#: tfrmviewer.lblhightlight.caption
|
|
msgid "0x0"
|
|
msgstr "0x0"
|
|
|
|
#: tfrmviewer.miabout.caption
|
|
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
|
|
msgid "About"
|
|
msgstr "Sobre"
|
|
|
|
#: tfrmviewer.midiv1.caption
|
|
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmviewer.midiv2.caption
|
|
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmviewer.midiv3.caption
|
|
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmviewer.midiv4.caption
|
|
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmviewer.midiv5.caption
|
|
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmviewer.miedit.caption
|
|
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
|
|
msgid "&Edit"
|
|
msgstr "&Editar"
|
|
|
|
#: tfrmviewer.miencoding.caption
|
|
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
|
|
msgid "En&coding"
|
|
msgstr "&Codificar"
|
|
|
|
#: tfrmviewer.mifile.caption
|
|
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
|
|
msgid "&File"
|
|
msgstr "&arquivo"
|
|
|
|
#: tfrmviewer.miimage.caption
|
|
msgid "&Image"
|
|
msgstr "&Imagem"
|
|
|
|
#: tfrmviewer.miprint.caption
|
|
msgid "Print..."
|
|
msgstr "Imprimir..."
|
|
|
|
#: tfrmviewer.mirotate.caption
|
|
msgctxt "TFRMVIEWER.MIROTATE.CAPTION"
|
|
msgid "Rotate"
|
|
msgstr "Rodar"
|
|
|
|
#: tfrmviewer.miscreenshot.caption
|
|
msgctxt "TFRMVIEWER.MISCREENSHOT.CAPTION"
|
|
msgid "Screenshot"
|
|
msgstr "Captura de ecrã"
|
|
|
|
#: tfrmviewer.miseparator.caption
|
|
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
|
|
msgid "-"
|
|
msgstr "-"
|
|
|
|
#: tfrmviewer.miview.caption
|
|
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
|
|
msgid "&View"
|
|
msgstr "&Ver"
|
|
|
|
#: tfrmviewer.pmiselectall.caption
|
|
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
|
|
msgid "Select All"
|
|
msgstr "Selecionar tudo"
|
|
|
|
#: tfrmviewoperations.btnstartpause.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.btnstartpause.caption"
|
|
msgid "&Start"
|
|
msgstr "&Iniciar"
|
|
|
|
#: tfrmviewoperations.btnstop.caption
|
|
msgid "S&top"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.caption"
|
|
msgid "File operations"
|
|
msgstr "Operações de arquivos"
|
|
|
|
#: tfrmviewoperations.cbalwaysontop.caption
|
|
msgid "Always on top"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.lblusedragdrop.caption
|
|
msgid "&Use \"drag && drop\" to move operations between queues"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.mnucanceloperation.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnucanceloperation.caption"
|
|
msgid "Cancel"
|
|
msgstr "Cancelar"
|
|
|
|
#: tfrmviewoperations.mnucancelqueue.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnucancelqueue.caption"
|
|
msgid "Cancel"
|
|
msgstr "Cancelar"
|
|
|
|
#: tfrmviewoperations.mnunewqueue.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnunewqueue.caption"
|
|
msgid "New queue"
|
|
msgstr "Nova fila"
|
|
|
|
#: tfrmviewoperations.mnuoperationshowdetached.caption
|
|
msgctxt "tfrmviewoperations.mnuoperationshowdetached.caption"
|
|
msgid "Show in detached window"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.mnuputfirstinqueue.caption
|
|
msgid "Put first in queue"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.mnuputlastinqueue.caption
|
|
msgid "Put last in queue"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.mnuqueue.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnuqueue.caption"
|
|
msgid "Queue"
|
|
msgstr "Fila"
|
|
|
|
#: tfrmviewoperations.mnuqueue0.caption
|
|
msgid "Out of queue"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.mnuqueue1.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnuqueue1.caption"
|
|
msgid "Queue 1"
|
|
msgstr "Fila 1"
|
|
|
|
#: tfrmviewoperations.mnuqueue2.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnuqueue2.caption"
|
|
msgid "Queue 2"
|
|
msgstr "Fila 2"
|
|
|
|
#: tfrmviewoperations.mnuqueue3.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnuqueue3.caption"
|
|
msgid "Queue 3"
|
|
msgstr "Fila 3"
|
|
|
|
#: tfrmviewoperations.mnuqueue4.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnuqueue4.caption"
|
|
msgid "Queue 4"
|
|
msgstr "Fila 4"
|
|
|
|
#: tfrmviewoperations.mnuqueue5.caption
|
|
#, fuzzy
|
|
msgctxt "tfrmviewoperations.mnuqueue5.caption"
|
|
msgid "Queue 5"
|
|
msgstr "Fila 5"
|
|
|
|
#: tfrmviewoperations.mnuqueueshowdetached.caption
|
|
msgctxt "tfrmviewoperations.mnuqueueshowdetached.caption"
|
|
msgid "Show in detached window"
|
|
msgstr ""
|
|
|
|
#: tfrmviewoperations.tbpauseall.caption
|
|
msgid "&Pause all"
|
|
msgstr ""
|
|
|
|
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
|
|
msgctxt "TMULTIARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
|
msgid "When file exists"
|
|
msgstr "Quando o arquivo existir"
|
|
|
|
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
|
|
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
|
msgid "When file exists"
|
|
msgstr "Quando o arquivo existir"
|
|
|
|
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
|
|
#, fuzzy
|
|
msgctxt "twfxplugincopymoveoperationoptionsui.cbcopytime.caption"
|
|
msgid "Copy d&ate/time"
|
|
msgstr "Copiar d&ata/hora"
|
|
|
|
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
|
|
msgid "Work in background (separate connection)"
|
|
msgstr "Trabalhar em 2º plano (ligação separada)"
|
|
|
|
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
|
|
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
|
|
msgid "When file exists"
|
|
msgstr "Quando o arquivo existir"
|
|
|
|
#: uexifreader.rsdatetimeoriginal
|
|
msgid "Date taken"
|
|
msgstr ""
|
|
|
|
#: uexifreader.rsimageheight
|
|
#, fuzzy
|
|
msgctxt "uexifreader.rsimageheight"
|
|
msgid "Height"
|
|
msgstr "Altura"
|
|
|
|
#: uexifreader.rsimagewidth
|
|
#, fuzzy
|
|
msgctxt "uexifreader.rsimagewidth"
|
|
msgid "Width"
|
|
msgstr "Largura"
|
|
|
|
#: uexifreader.rsmake
|
|
msgid "Manufacturer"
|
|
msgstr ""
|
|
|
|
#: uexifreader.rsmodel
|
|
msgid "Camera model"
|
|
msgstr ""
|
|
|
|
#: uexifreader.rsorientation
|
|
msgid "Orientation"
|
|
msgstr ""
|
|
|
|
#: ulng.msgtrytolocatecrcfile
|
|
msgid ""
|
|
"This file cannot be found and could help to validate final combination of files:\n"
|
|
"%s\n"
|
|
"\n"
|
|
"Could you make it available and press \"OK\" when ready,\n"
|
|
"or press \"CANCEL\" to continue without it?\n"
|
|
msgstr ""
|
|
"Este arquivo não pode ser encontrado e pode ajudar a validar a combinação final de arquivos:\n"
|
|
"%s\n"
|
|
"\n"
|
|
"Você poderia disponibilizá-lo e pressionar \"OK\" quando pronto,\n"
|
|
"ou pressionar \"CANCELAR\" para contnuar sem ele?\n"
|
|
|
|
#: ulng.rscancelfilter
|
|
msgid "Cancel Quick Filter"
|
|
msgstr "Cancelar filtro rápido"
|
|
|
|
#: ulng.rscanceloperation
|
|
msgid "Cancel Current Operation"
|
|
msgstr "Cancelar operação atual"
|
|
|
|
#: ulng.rscaptionforaskingfilename
|
|
msgid "Enter filename, with extension, for dropped text"
|
|
msgstr "Digite o nome do arquivo, com extensão, para o texto descartado"
|
|
|
|
#: ulng.rscaptionfortextformattoimport
|
|
msgid "Text format to import"
|
|
msgstr "Texto formatado para importar"
|
|
|
|
#: ulng.rschecksumverifybroken
|
|
msgid "Broken:"
|
|
msgstr "Quebrado:"
|
|
|
|
#: ulng.rschecksumverifygeneral
|
|
msgid "General:"
|
|
msgstr "Geral:"
|
|
|
|
#: ulng.rschecksumverifymissing
|
|
msgid "Missing:"
|
|
msgstr "Perdido:"
|
|
|
|
#: ulng.rschecksumverifyreaderror
|
|
msgid "Read error:"
|
|
msgstr "Erro de leitura:"
|
|
|
|
#: ulng.rschecksumverifysuccess
|
|
msgid "Success:"
|
|
msgstr "Sucesso"
|
|
|
|
#: ulng.rschecksumverifytext
|
|
msgid "Enter checksum and select algorithm:"
|
|
msgstr "Digite checksum e selecione algoritmo:"
|
|
|
|
#: ulng.rschecksumverifytitle
|
|
msgid "Verify checksum"
|
|
msgstr "Verificar checksum"
|
|
|
|
#: ulng.rschecksumverifytotal
|
|
msgid "Total:"
|
|
msgstr "Total:"
|
|
|
|
#: ulng.rsclearfiltersornot
|
|
msgid "Do you want to clear filters for this new search?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsclipboardcontainsinvalidtoolbardata
|
|
msgid "Clipboard doesn't contain any valid toolbar data."
|
|
msgstr "A área de transferência não contém dados de barra de ferrramentas válidos"
|
|
|
|
#: ulng.rscmdcategorylistinorder
|
|
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
|
|
msgstr "Todos, Painel Ativo, Painel Esquerdo, Painel Direito, Operações de Arquivo, Configuração, Rede, Diversos, Porta Paralela, Impressão, Marca, Segurança, Área de Transferência, FTP, Navegação, Ajuda, Janela, Linha de Comando, Ferramentas, Vista, Usuário, Ordenação; Registro"
|
|
|
|
#: ulng.rscmdkindofsort
|
|
msgid "Legacy sorted;A-Z sorted"
|
|
msgstr "Legado classificado; A-Z classificado"
|
|
|
|
#: ulng.rscolattr
|
|
msgid "Attr"
|
|
msgstr "Atr"
|
|
|
|
#: ulng.rscoldate
|
|
msgctxt "ulng.rscoldate"
|
|
msgid "Date"
|
|
msgstr "Data"
|
|
|
|
#: ulng.rscolext
|
|
msgid "Ext"
|
|
msgstr "Ext"
|
|
|
|
#: ulng.rscolname
|
|
msgctxt "ulng.rscolname"
|
|
msgid "Name"
|
|
msgstr "Nome"
|
|
|
|
#: ulng.rscolsize
|
|
msgctxt "ulng.rscolsize"
|
|
msgid "Size"
|
|
msgstr "Tamanho"
|
|
|
|
#: ulng.rsconfcolalign
|
|
msgid "Align"
|
|
msgstr "Alinhar"
|
|
|
|
#: ulng.rsconfcolcaption
|
|
msgid "Caption"
|
|
msgstr "Legenda"
|
|
|
|
#: ulng.rsconfcoldelete
|
|
msgctxt "ulng.rsconfcoldelete"
|
|
msgid "Delete"
|
|
msgstr "Excluir"
|
|
|
|
#: ulng.rsconfcolfieldcont
|
|
msgid "Field contents"
|
|
msgstr "Conteúdo do campo"
|
|
|
|
#: ulng.rsconfcolmove
|
|
msgctxt "ulng.rsconfcolmove"
|
|
msgid "Move"
|
|
msgstr "Mover"
|
|
|
|
#: ulng.rsconfcolwidth
|
|
msgctxt "ulng.rsconfcolwidth"
|
|
msgid "Width"
|
|
msgstr "Largura"
|
|
|
|
#: ulng.rsconfcustheader
|
|
msgid "Customize column"
|
|
msgstr "Personalizar coluna"
|
|
|
|
#: ulng.rsconfigurationfileassociation
|
|
msgid "Configure file association"
|
|
msgstr "Configurar associação de arquivo"
|
|
|
|
#: ulng.rsconfirmexecution
|
|
msgid "Confirming command line and parameters"
|
|
msgstr "Confirmando linha de comando e parâmetros"
|
|
|
|
#: ulng.rscopynametemplate
|
|
msgid "Copy (%d) %s"
|
|
msgstr "Copiar (%d) %s"
|
|
|
|
#: ulng.rsdefaultimporteddctoolbarhint
|
|
msgid "Imported DC toolbar"
|
|
msgstr "Barra de Ferramentas DC importada"
|
|
|
|
#: ulng.rsdefaultimportedtctoolbarhint
|
|
msgid "Imported TC toolbar"
|
|
msgstr "Barra de Ferramentas DC importada"
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtext
|
|
msgid "_DroppedText"
|
|
msgstr "_Texto Descartado"
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
|
|
msgid "_DroppedHTMLtext"
|
|
msgstr "_HTML texto Descartado"
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
|
|
msgid "_DroppedRichtext"
|
|
msgstr "_Richtext texto Descartado"
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
|
|
msgid "_DroppedSimpleText"
|
|
msgstr "_Simples texto Descartado"
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
|
|
msgid "_DroppedUnicodeUTF16text"
|
|
msgstr "_UnicodeUTF16 texto Descartado"
|
|
|
|
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
|
|
msgid "_DroppedUnicodeUTF8text"
|
|
msgstr "_UnicodeUTF8 texto Descartado"
|
|
|
|
#: ulng.rsdiffadds
|
|
msgid " Adds: "
|
|
msgstr "Acrescentar: "
|
|
|
|
#: ulng.rsdiffdeletes
|
|
msgid " Deletes: "
|
|
msgstr "Excluidos: "
|
|
|
|
#: ulng.rsdifffilesidentical
|
|
msgid "The two files are identical!"
|
|
msgstr "Os dois arquivos são idênticos"
|
|
|
|
#: ulng.rsdiffmatches
|
|
msgid " Matches: "
|
|
msgstr "Correspondentes: "
|
|
|
|
#: ulng.rsdiffmodifies
|
|
msgid " Modifies: "
|
|
msgstr "Modificados: "
|
|
|
|
#: ulng.rsdlgbuttonabort
|
|
msgid "Ab&ort"
|
|
msgstr "Ab&ortar"
|
|
|
|
#: ulng.rsdlgbuttonall
|
|
msgctxt "ulng.rsdlgbuttonall"
|
|
msgid "A&ll"
|
|
msgstr "T&udo"
|
|
|
|
#: ulng.rsdlgbuttonappend
|
|
msgid "A&ppend"
|
|
msgstr "Jun&tar"
|
|
|
|
#: ulng.rsdlgbuttonautorenamesource
|
|
msgid "A&uto-rename source files"
|
|
msgstr "Auto renomer arquivos fonte"
|
|
|
|
#: ulng.rsdlgbuttoncancel
|
|
msgctxt "ulng.rsdlgbuttoncancel"
|
|
msgid "&Cancel"
|
|
msgstr "&Cancelar"
|
|
|
|
#: ulng.rsdlgbuttoncompare
|
|
msgid "Compare &by content"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdlgbuttoncontinue
|
|
msgid "&Continue"
|
|
msgstr "&Continuar"
|
|
|
|
#: ulng.rsdlgbuttoncopyinto
|
|
#, fuzzy
|
|
#| msgid "Copy &Into"
|
|
msgid "&Merge"
|
|
msgstr "Cop&iar para"
|
|
|
|
#: ulng.rsdlgbuttoncopyintoall
|
|
#, fuzzy
|
|
#| msgid "Copy Into &All"
|
|
msgid "Mer&ge All"
|
|
msgstr "Copi&ar todos para"
|
|
|
|
#: ulng.rsdlgbuttonexitprogram
|
|
msgid "E&xit program"
|
|
msgstr "&Sair do programa"
|
|
|
|
#: ulng.rsdlgbuttonignore
|
|
msgid "Ig&nore"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdlgbuttonignoreall
|
|
msgid "I&gnore All"
|
|
msgstr "I&gnorar todos"
|
|
|
|
#: ulng.rsdlgbuttonno
|
|
msgid "&No"
|
|
msgstr "&Não"
|
|
|
|
#: ulng.rsdlgbuttonnone
|
|
msgid "Non&e"
|
|
msgstr "N&enhum"
|
|
|
|
#: ulng.rsdlgbuttonok
|
|
msgctxt "ulng.rsdlgbuttonok"
|
|
msgid "&OK"
|
|
msgstr "&OK"
|
|
|
|
#: ulng.rsdlgbuttonother
|
|
msgid "Ot&her"
|
|
msgstr "Ou&tros"
|
|
|
|
#: ulng.rsdlgbuttonoverwrite
|
|
msgid "&Overwrite"
|
|
msgstr "S&ubstituir"
|
|
|
|
#: ulng.rsdlgbuttonoverwriteall
|
|
msgid "Overwrite &All"
|
|
msgstr "Su&bstituir todos"
|
|
|
|
#: ulng.rsdlgbuttonoverwritelarger
|
|
msgid "Overwrite All &Larger"
|
|
msgstr "Substituir Todos &Maiores"
|
|
|
|
#: ulng.rsdlgbuttonoverwriteolder
|
|
msgid "Overwrite All Ol&der"
|
|
msgstr "Subs&tituir mais antigos"
|
|
|
|
#: ulng.rsdlgbuttonoverwritesmaller
|
|
msgid "Overwrite All S&maller"
|
|
msgstr "Substituir Todos &Menores"
|
|
|
|
#: ulng.rsdlgbuttonrename
|
|
msgctxt "ulng.rsdlgbuttonrename"
|
|
msgid "R&ename"
|
|
msgstr "R&enomear"
|
|
|
|
#: ulng.rsdlgbuttonresume
|
|
msgid "&Resume"
|
|
msgstr "&Recomeçar"
|
|
|
|
#: ulng.rsdlgbuttonretry
|
|
msgid "Re&try"
|
|
msgstr "Repe&tir"
|
|
|
|
#: ulng.rsdlgbuttonretryadmin
|
|
msgid "As Ad&ministrator"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdlgbuttonskip
|
|
msgid "&Skip"
|
|
msgstr "&Saltar"
|
|
|
|
#: ulng.rsdlgbuttonskipall
|
|
msgid "S&kip All"
|
|
msgstr "Sa<ar todos"
|
|
|
|
#: ulng.rsdlgbuttonyes
|
|
msgid "&Yes"
|
|
msgstr "S&im"
|
|
|
|
#: ulng.rsdlgcp
|
|
msgctxt "ulng.rsdlgcp"
|
|
msgid "Copy file(s)"
|
|
msgstr "Copiar arquivo(s)"
|
|
|
|
#: ulng.rsdlgmv
|
|
msgid "Move file(s)"
|
|
msgstr "Mover arquivo(s)"
|
|
|
|
#: ulng.rsdlgoppause
|
|
msgctxt "ulng.rsdlgoppause"
|
|
msgid "Pau&se"
|
|
msgstr "Pau&sa"
|
|
|
|
#: ulng.rsdlgopstart
|
|
msgctxt "ulng.rsdlgopstart"
|
|
msgid "&Start"
|
|
msgstr "&Iniciar"
|
|
|
|
#: ulng.rsdlgqueue
|
|
msgctxt "ulng.rsdlgqueue"
|
|
msgid "Queue"
|
|
msgstr "Fila"
|
|
|
|
#: ulng.rsdlgspeed
|
|
msgid "Speed %s/s"
|
|
msgstr "Velocidade %s/s"
|
|
|
|
#: ulng.rsdlgspeedtime
|
|
msgid "Speed %s/s, time remaining %s"
|
|
msgstr "Velocidade %s/s, falta %s"
|
|
|
|
#: ulng.rsdraganddroptextformat
|
|
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
|
|
msgstr ""
|
|
|
|
#: ulng.rsdrivenolabel
|
|
msgid "<no label>"
|
|
msgstr "<sem rótulo>"
|
|
|
|
#: ulng.rsdrivenomedia
|
|
msgid "<no media>"
|
|
msgstr "<sem mídia>"
|
|
|
|
#: ulng.rseditabouttext
|
|
msgid "Internal Editor of Double Commander."
|
|
msgstr "Editor interno do Double Commander."
|
|
|
|
#: ulng.rseditgotolinequery
|
|
msgid "Goto line:"
|
|
msgstr "Vá para linha:"
|
|
|
|
#: ulng.rseditgotolinetitle
|
|
msgctxt "ulng.rseditgotolinetitle"
|
|
msgid "Goto Line"
|
|
msgstr "Vá para linha"
|
|
|
|
#: ulng.rseditnewfile
|
|
msgid "new.txt"
|
|
msgstr "novo.txt"
|
|
|
|
#: ulng.rseditnewfilename
|
|
msgid "Filename:"
|
|
msgstr "Nome de arquivo:"
|
|
|
|
#: ulng.rseditnewopen
|
|
msgid "Open file"
|
|
msgstr "Abrir arquivo"
|
|
|
|
#: ulng.rseditsearchback
|
|
msgid "&Backward"
|
|
msgstr "&Recuar"
|
|
|
|
#: ulng.rseditsearchcaption
|
|
msgctxt "ulng.rseditsearchcaption"
|
|
msgid "Search"
|
|
msgstr "Localizar"
|
|
|
|
#: ulng.rseditsearchfrw
|
|
msgid "&Forward"
|
|
msgstr "&Avançar"
|
|
|
|
#: ulng.rseditsearchreplace
|
|
msgctxt "ulng.rseditsearchreplace"
|
|
msgid "Replace"
|
|
msgstr "Substituir"
|
|
|
|
#: ulng.rseditwithexternaleditor
|
|
msgid "with external editor"
|
|
msgstr "com editor externo."
|
|
|
|
#: ulng.rseditwithinternaleditor
|
|
msgid "with internal editor"
|
|
msgstr "com editor"
|
|
|
|
#: ulng.rsexecuteviashell
|
|
msgctxt "ulng.rsexecuteviashell"
|
|
msgid "Execute via shell"
|
|
msgstr "Executar via shell."
|
|
|
|
#: ulng.rsexecuteviaterminalclose
|
|
msgctxt "ulng.rsexecuteviaterminalclose"
|
|
msgid "Execute via terminal and close"
|
|
msgstr "Executar via terminal e fechar."
|
|
|
|
#: ulng.rsexecuteviaterminalstayopen
|
|
msgctxt "ulng.rsexecuteviaterminalstayopen"
|
|
msgid "Execute via terminal and stay open"
|
|
msgstr "Executar via terminal e manter aberto."
|
|
|
|
#: ulng.rsfavtabspanelsideselection
|
|
msgid "Left;Right;Active;Inactive;Both;None"
|
|
msgstr "Esquerda;Direita;Ativo;Inativo:Ambos;Nenhum"
|
|
|
|
#: ulng.rsfavtabssavedirhistory
|
|
msgid "No;Yes"
|
|
msgstr "Não;Sim"
|
|
|
|
#: ulng.rsfilenameexportedtcbarprefix
|
|
msgid "Exported_from_DC"
|
|
msgstr "Exportado do DC"
|
|
|
|
#: ulng.rsfileopdirectoryexistsoptions
|
|
#, fuzzy
|
|
#| msgid "Ask;Overwrite;Copy into;Skip"
|
|
msgid "Ask;Merge;Skip"
|
|
msgstr "Perguntar;Substituir;Copiar para;Saltar"
|
|
|
|
#: ulng.rsfileopfileexistsoptions
|
|
msgid "Ask;Overwrite;Overwrite Older;Skip"
|
|
msgstr "Perguntar;Substituir;Substituir mais antigos;Saltar"
|
|
|
|
#: ulng.rsfileopsetpropertyerroroptions
|
|
msgctxt "ulng.rsfileopsetpropertyerroroptions"
|
|
msgid "Ask;Don't set anymore;Ignore errors"
|
|
msgstr "Perguntar;Não definir mais;Ignorar erros"
|
|
|
|
#: ulng.rsfilterstatus
|
|
msgid "FILTER"
|
|
msgstr "FILTRO"
|
|
|
|
#: ulng.rsfinddefinetemplate
|
|
msgid "Define template"
|
|
msgstr "Definir modelo"
|
|
|
|
#: ulng.rsfinddepth
|
|
msgid "%s level(s)"
|
|
msgstr "%s níveis"
|
|
|
|
#: ulng.rsfinddepthall
|
|
msgid "all (unlimited depth)"
|
|
msgstr "todos (profundidade ilimitada)"
|
|
|
|
#: ulng.rsfinddepthcurdir
|
|
msgid "current dir only"
|
|
msgstr "só pasta atual"
|
|
|
|
#: ulng.rsfinddirnoex
|
|
msgid "Directory %s does not exist!"
|
|
msgstr "A pasta %s não existe!"
|
|
|
|
#: ulng.rsfindfound
|
|
msgctxt "ulng.rsfindfound"
|
|
msgid "Found: %d"
|
|
msgstr "Encontrados: %d"
|
|
|
|
#: ulng.rsfindsavetemplatecaption
|
|
msgid "Save search template"
|
|
msgstr "Salvar modelo de procura"
|
|
|
|
#: ulng.rsfindsavetemplatetitle
|
|
msgid "Template name:"
|
|
msgstr "Nome do modelo:"
|
|
|
|
#: ulng.rsfindscanned
|
|
msgctxt "ulng.rsfindscanned"
|
|
msgid "Scanned: %d"
|
|
msgstr "Pesquisado: %d"
|
|
|
|
#: ulng.rsfindscanning
|
|
msgid "Scanning"
|
|
msgstr "A pesquisar"
|
|
|
|
#: ulng.rsfindsearchfiles
|
|
msgctxt "ulng.rsfindsearchfiles"
|
|
msgid "Find files"
|
|
msgstr "Localizar arquivos"
|
|
|
|
#: ulng.rsfindtimeofscan
|
|
msgid "Time of scan: "
|
|
msgstr "Tempo da varredra: "
|
|
|
|
#: ulng.rsfindwherebeg
|
|
msgid "Begin at"
|
|
msgstr "Iniciar em"
|
|
|
|
#: ulng.rsfreemsg
|
|
msgid "Free %s from %s bytes"
|
|
msgstr "Livres %s de %s bytes"
|
|
|
|
#: ulng.rsfreemsgshort
|
|
msgid "%s bytes free"
|
|
msgstr "%s bytes livres"
|
|
|
|
#: ulng.rsfuncatime
|
|
msgid "Access date/time"
|
|
msgstr "Aceder a data/hora"
|
|
|
|
#: ulng.rsfuncattr
|
|
msgctxt "ulng.rsfuncattr"
|
|
msgid "Attributes"
|
|
msgstr "Atributos"
|
|
|
|
#: ulng.rsfunccomment
|
|
msgctxt "ulng.rsfunccomment"
|
|
msgid "Comment"
|
|
msgstr "Comentário"
|
|
|
|
#: ulng.rsfunccompressedsize
|
|
msgid "Compressed size"
|
|
msgstr "Tamanho comprimido"
|
|
|
|
#: ulng.rsfuncctime
|
|
msgid "Creation date/time"
|
|
msgstr "Data/hora de criação"
|
|
|
|
#: ulng.rsfuncext
|
|
msgid "Extension"
|
|
msgstr "Extensão"
|
|
|
|
#: ulng.rsfuncgroup
|
|
msgctxt "ulng.rsfuncgroup"
|
|
msgid "Group"
|
|
msgstr "Grupo"
|
|
|
|
#: ulng.rsfunchtime
|
|
msgid "Change date/time"
|
|
msgstr "Alterar data/hora"
|
|
|
|
#: ulng.rsfunclinkto
|
|
msgid "Link to"
|
|
msgstr "conectar a"
|
|
|
|
#: ulng.rsfuncmtime
|
|
msgid "Modification date/time"
|
|
msgstr "Data/hora de modificação"
|
|
|
|
#: ulng.rsfuncname
|
|
msgctxt "ulng.rsfuncname"
|
|
msgid "Name"
|
|
msgstr "Nome"
|
|
|
|
#: ulng.rsfuncnamenoext
|
|
msgid "Name without extension"
|
|
msgstr "Nome sem extensão"
|
|
|
|
#: ulng.rsfuncowner
|
|
msgctxt "ulng.rsfuncowner"
|
|
msgid "Owner"
|
|
msgstr "Proprietário"
|
|
|
|
#: ulng.rsfuncpath
|
|
msgctxt "ulng.rsfuncpath"
|
|
msgid "Path"
|
|
msgstr "Caminho"
|
|
|
|
#: ulng.rsfuncsize
|
|
msgctxt "ulng.rsfuncsize"
|
|
msgid "Size"
|
|
msgstr "Tamanho"
|
|
|
|
#: ulng.rsfunctype
|
|
msgid "Type"
|
|
msgstr "Tipo"
|
|
|
|
#: ulng.rsharderrcreate
|
|
msgid "Error creating hardlink."
|
|
msgstr "Erro ao criar ligação física"
|
|
|
|
#: ulng.rshotdirforcesortingorderchoices
|
|
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
|
|
msgstr "nenhum;Nome, a-z;Nome, z-a;Ext, a-z;Ext, z-a;Tam 9-0;Tam 0-9;Data 9-0;Data 0-9"
|
|
|
|
#: ulng.rshotdirwarningabortrestorebackup
|
|
msgid ""
|
|
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
|
|
"\n"
|
|
"Are you sure you want to proceed?\n"
|
|
msgstr ""
|
|
"Aviso! Ao restaurar um backup do arquivo .hotlist, Isso irá apagar a lista existente para substituir pelo importado.\n"
|
|
"\n"
|
|
"Tem certeza que quer continuar?\n"
|
|
|
|
#: ulng.rshotkeycategorycopymovedialog
|
|
msgid "Copy/Move Dialog"
|
|
msgstr "Copiar/Mover diálogo"
|
|
|
|
#: ulng.rshotkeycategorydiffer
|
|
msgctxt "ulng.rshotkeycategorydiffer"
|
|
msgid "Differ"
|
|
msgstr "Diferenciar"
|
|
|
|
#: ulng.rshotkeycategoryeditcommentdialog
|
|
msgid "Edit Comment Dialog"
|
|
msgstr "Editar Diálogo de Comentário"
|
|
|
|
#: ulng.rshotkeycategoryeditor
|
|
msgctxt "ulng.rshotkeycategoryeditor"
|
|
msgid "Editor"
|
|
msgstr "Editor"
|
|
|
|
#: ulng.rshotkeycategoryfindfiles
|
|
msgctxt "ulng.rshotkeycategoryfindfiles"
|
|
msgid "Find files"
|
|
msgstr "Localizar arquivos"
|
|
|
|
#: ulng.rshotkeycategorymain
|
|
msgid "Main"
|
|
msgstr "Principal"
|
|
|
|
#: ulng.rshotkeycategorysyncdirs
|
|
msgid "Synchronize Directories"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeycategoryviewer
|
|
msgctxt "ulng.rshotkeycategoryviewer"
|
|
msgid "Viewer"
|
|
msgstr "Visualizador"
|
|
|
|
#: ulng.rshotkeyfilealreadyexists
|
|
msgid ""
|
|
"A setup with that name already exists.\n"
|
|
"Do you want to overwrite it?\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfileconfirmdefault
|
|
msgid "Are you sure you want to restore default?"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfileconfirmerasure
|
|
msgid "Are you sure you want to erase setup \"%s\"?"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfilecopyof
|
|
msgid "Copy of %s"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfileinputnewname
|
|
msgid "Input your new name"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfilemustkeepone
|
|
msgid "You must keep at least one shortcut file."
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfilenewname
|
|
msgid "New name"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeyfilesavemodified
|
|
msgid ""
|
|
"\"%s\" setup has been modified.\n"
|
|
"Do you want to save it now?\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeynoscenter
|
|
msgid "No shortcut with \"ENTER\""
|
|
msgstr ""
|
|
|
|
#: ulng.rshotkeysortorder
|
|
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsimporttoolbarproblem
|
|
msgid "Cannot find reference to default bar file"
|
|
msgstr "Não é possível encontrar referência ao arquivo de barra de ferramentas padrão"
|
|
|
|
#: ulng.rslistoffindfileswindows
|
|
msgid "List of \"Find files\" windows"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmarkminus
|
|
msgid "Unselect mask"
|
|
msgstr "Remover seleção da máscara"
|
|
|
|
#: ulng.rsmarkplus
|
|
msgid "Select mask"
|
|
msgstr "Selecionar máscara"
|
|
|
|
#: ulng.rsmaskinput
|
|
msgid "Input mask:"
|
|
msgstr "Máscara de entrada:"
|
|
|
|
#: ulng.rsmenuconfigurecolumnsalreadyexists
|
|
msgid "A columns view with that name already exists."
|
|
msgstr "Já existe uma visão de colunas com esse nome."
|
|
|
|
#: ulng.rsmenuconfigurecolumnssavetochange
|
|
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
|
|
msgstr "Para alterar a visualização atual das colunas de edição, SAVLVA, COPIA ou APAGUE"
|
|
|
|
#: ulng.rsmenuconfigurecustomcolumns
|
|
msgid "Configure custom columns"
|
|
msgstr "Configurar colunas personalizadas"
|
|
|
|
#: ulng.rsmenuconfigureentercustomcolumnname
|
|
msgid "Enter new custom columns name"
|
|
msgstr "Digite nome das novas colunas personalizadas"
|
|
|
|
#: ulng.rsmnuactions
|
|
msgctxt "ulng.rsmnuactions"
|
|
msgid "Actions"
|
|
msgstr "Ações"
|
|
|
|
#: ulng.rsmnucontentdefault
|
|
msgid "<Default>"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnucontentoctal
|
|
msgid "Octal"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnucopynetnamestoclip
|
|
msgid "Copy names with UNC path"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmnudisconnectnetworkdrive
|
|
msgid "Disconnect Network Drive..."
|
|
msgstr "Desconectado do Drive de Rede"
|
|
|
|
#: ulng.rsmnuedit
|
|
msgctxt "ulng.rsmnuedit"
|
|
msgid "Edit"
|
|
msgstr "Editar"
|
|
|
|
#: ulng.rsmnueject
|
|
msgid "Eject"
|
|
msgstr "Ejetar"
|
|
|
|
#: ulng.rsmnuextracthere
|
|
msgid "Extract here..."
|
|
msgstr "Extrair aqui..."
|
|
|
|
#: ulng.rsmnumapnetworkdrive
|
|
msgid "Map Network Drive..."
|
|
msgstr "Mapa do Drive de Rede"
|
|
|
|
#: ulng.rsmnumount
|
|
msgid "Mount"
|
|
msgstr "Montar"
|
|
|
|
#: ulng.rsmnunew
|
|
msgctxt "ulng.rsmnunew"
|
|
msgid "New"
|
|
msgstr "Novo"
|
|
|
|
#: ulng.rsmnunomedia
|
|
msgid "No media available"
|
|
msgstr "Nenhuma mídia disponível"
|
|
|
|
#: ulng.rsmnuopen
|
|
msgctxt "ulng.rsmnuopen"
|
|
msgid "Open"
|
|
msgstr "Abrir"
|
|
|
|
#: ulng.rsmnuopenwith
|
|
msgid "Open with"
|
|
msgstr "Abrir com"
|
|
|
|
#: ulng.rsmnuopenwithother
|
|
msgctxt "ulng.rsmnuopenwithother"
|
|
msgid "Other..."
|
|
msgstr "Outro..."
|
|
|
|
#: ulng.rsmnupackhere
|
|
msgid "Pack here..."
|
|
msgstr "Compacte aqui..."
|
|
|
|
#: ulng.rsmnusortby
|
|
msgid "Sort by"
|
|
msgstr "Ordenar por"
|
|
|
|
#: ulng.rsmnuumount
|
|
msgid "Unmount"
|
|
msgstr "Desmontar"
|
|
|
|
#: ulng.rsmnuview
|
|
msgctxt "ulng.rsmnuview"
|
|
msgid "View"
|
|
msgstr "Ver"
|
|
|
|
#: ulng.rsmsgaccount
|
|
msgid "Account:"
|
|
msgstr "Conta:"
|
|
|
|
#: ulng.rsmsgalldcintcmds
|
|
msgid "All Double Commander internal commands"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgarchivercustomparams
|
|
msgid "Additional parameters for archiver command-line:"
|
|
msgstr "Parâmetros adicionais da linha de comandos do arquivador:"
|
|
|
|
#: ulng.rsmsgaskquoteornot
|
|
msgid "Do you want to enclose between quotes?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgbadcrc32
|
|
msgid ""
|
|
"Bad CRC32 for resulting file:\n"
|
|
"\"%s\"\n"
|
|
"\n"
|
|
"Do you want to keep the resulting corrupted file anyway?\n"
|
|
msgstr ""
|
|
"CRC32 incorreto para o arquivo resultante: \n"
|
|
"\"%s\"\n"
|
|
"\n"
|
|
"Você deseja manter o arquivo corrompido resultante de qualquer maneira?\n"
|
|
|
|
#: ulng.rsmsgcannotcopymoveitself
|
|
msgid "You can not copy/move a file \"%s\" to itself!"
|
|
msgstr "Não pode copiar/mover um arquivo \"%s\" para si próprio!"
|
|
|
|
#: ulng.rsmsgcannotdeletedirectory
|
|
msgid "Cannot delete directory %s"
|
|
msgstr "Impossível Excluir a pasta %s"
|
|
|
|
#: ulng.rsmsgcannotoverwritedirectory
|
|
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgchdirfailed
|
|
msgid "ChDir to [%s] failed!"
|
|
msgstr "ChDir para [%s] falhou!"
|
|
|
|
#: ulng.rsmsgcloseallinactivetabs
|
|
msgid "Remove all inactive tabs?"
|
|
msgstr "Remover as guias inativas?"
|
|
|
|
#: ulng.rsmsgcloselockedtab
|
|
msgid "This tab (%s) is locked! Close anyway?"
|
|
msgstr "Esta guia (%s) está bloqueado! Fechar mesmo assim?"
|
|
|
|
#: ulng.rsmsgcofirmuserparam
|
|
msgid "Confirmation of parameter"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgconfirmquit
|
|
msgid "Are you sure you want to quit?"
|
|
msgstr "Tem a certeza que quer desistir?"
|
|
|
|
#: ulng.rsmsgcopybackward
|
|
msgid "The file %s has changed. Do you want to copy it backward?"
|
|
msgstr "O arquivo %s foi alterado. Deseja copiá-lo de volta?"
|
|
|
|
#: ulng.rsmsgcouldnotcopybackward
|
|
msgid "Could not copy backward - do you want to keep the changed file?"
|
|
msgstr "Não foi possível copiar de volta. Você deseja manter o arquivo alterado?"
|
|
|
|
#: ulng.rsmsgcpfldr
|
|
msgid "Copy %d selected files/directories?"
|
|
msgstr "Copiar %d arquivos/pastas selecionados?"
|
|
|
|
#: ulng.rsmsgcpsel
|
|
msgid "Copy selected \"%s\"?"
|
|
msgstr "Copiar \"%s\" selecionados?"
|
|
|
|
#: ulng.rsmsgcreateanewfiletype
|
|
msgid "< Create a new file type \"%s files\" >"
|
|
msgstr "< Criar um novo tipo de arquivo \"%s arquivos\" >"
|
|
|
|
#: ulng.rsmsgdctoolbarwheretosave
|
|
msgid "Enter location and filename where to save a DC Toolbar file"
|
|
msgstr "Digite a localização e o nome do arquivo onde salvar um arquivo da barra de ferramentas DC"
|
|
|
|
#: ulng.rsmsgdefaultcustomactionname
|
|
msgid "Custom action"
|
|
msgstr "Ação customizada"
|
|
|
|
#: ulng.rsmsgdeletepartiallycopied
|
|
msgid "Delete the partially copied file ?"
|
|
msgstr "Excluir o arquivo parcialmente copiado?"
|
|
|
|
#: ulng.rsmsgdelfldr
|
|
msgid "Delete %d selected files/directories?"
|
|
msgstr "Excluir %d arquivos/pastas selecionados?"
|
|
|
|
#: ulng.rsmsgdelfldrt
|
|
msgid "Delete %d selected files/directories into trash can?"
|
|
msgstr "Excluir %d arquivos/pastas selecionados para a lata de lixo?"
|
|
|
|
#: ulng.rsmsgdelsel
|
|
#, fuzzy,badformat
|
|
msgid "Delete selected \"%s\"?"
|
|
msgstr "Excluir %d arquivos/pastas selecionados?"
|
|
|
|
#: ulng.rsmsgdelselt
|
|
msgid "Delete selected \"%s\" into trash can?"
|
|
msgstr "Excluir \"%s\" selecionados para a lata de lixo?"
|
|
|
|
#: ulng.rsmsgdeltotrashforce
|
|
msgid "Can not delete \"%s\" to trash! Delete directly?"
|
|
msgstr "Impossível Excluir \"%s\" para o lixo! Excluir diretamente?"
|
|
|
|
#: ulng.rsmsgdisknotavail
|
|
msgid "Disk is not available"
|
|
msgstr "O disco não está disponível"
|
|
|
|
#: ulng.rsmsgentercustomaction
|
|
msgid "Enter custom action name:"
|
|
msgstr "Digite nome da ação customizada"
|
|
|
|
#: ulng.rsmsgenterfileext
|
|
msgid "Enter file extension:"
|
|
msgstr "Introduza a extensão do arquivo:"
|
|
|
|
#: ulng.rsmsgentername
|
|
msgid "Enter name:"
|
|
msgstr "Introduza o nome"
|
|
|
|
#: ulng.rsmsgenternewfiletypename
|
|
msgid "Enter name of new file type to create for extension \"%s\""
|
|
msgstr "Digite o nome do novo tipo de arquivo a ser criado para a extensão \"%s\""
|
|
|
|
#: ulng.rsmsgerrbadarchive
|
|
msgid "CRC error in archive data"
|
|
msgstr "Erro CRC nos dados arquivados"
|
|
|
|
#: ulng.rsmsgerrbaddata
|
|
msgid "Data is bad"
|
|
msgstr "Os dados estão corrompidos"
|
|
|
|
#: ulng.rsmsgerrcannotconnect
|
|
msgid "Can not connect to server: \"%s\""
|
|
msgstr "Impossível conectar ao servidor: \"%s\""
|
|
|
|
#: ulng.rsmsgerrcannotcopyfile
|
|
msgid "Cannot copy file %s to %s"
|
|
msgstr "Impossível copiar o arquivo %s para %s"
|
|
|
|
#: ulng.rsmsgerrcreatefiledirectoryexists
|
|
msgid "There already exists a directory named \"%s\"."
|
|
msgstr "Já existe uma pasta chamada \"%s\"."
|
|
|
|
#: ulng.rsmsgerrdatenotsupported
|
|
msgid "Date %s is not supported"
|
|
msgstr "Data %s não é suportada"
|
|
|
|
#: ulng.rsmsgerrdirexists
|
|
msgid "Directory %s exists!"
|
|
msgstr "A pasta %s já existe!"
|
|
|
|
#: ulng.rsmsgerreaborted
|
|
msgid "Function aborted by user"
|
|
msgstr "Funçção abortada pelo usuário"
|
|
|
|
#: ulng.rsmsgerreclose
|
|
msgid "Error closing file"
|
|
msgstr "Erro ao fechar o arquivo"
|
|
|
|
#: ulng.rsmsgerrecreate
|
|
msgid "Cannot create file"
|
|
msgstr "Impossível criar o arquivo"
|
|
|
|
#: ulng.rsmsgerrendarchive
|
|
msgid "No more files in archive"
|
|
msgstr "Não há mais arquivos no arquivo"
|
|
|
|
#: ulng.rsmsgerreopen
|
|
msgid "Cannot open existing file"
|
|
msgstr "Impossível abrir arquivo existente"
|
|
|
|
#: ulng.rsmsgerreread
|
|
msgid "Error reading from file"
|
|
msgstr "Erro ao ler o arquivo"
|
|
|
|
#: ulng.rsmsgerrewrite
|
|
msgid "Error writing to file"
|
|
msgstr "Erro ao escrever o arquivo"
|
|
|
|
#: ulng.rsmsgerrforcedir
|
|
msgid "Can not create directory %s!"
|
|
msgstr "Impossível criar a pasta %s!"
|
|
|
|
#: ulng.rsmsgerrinvalidlink
|
|
msgid "Invalid link"
|
|
msgstr "Link inválido"
|
|
|
|
#: ulng.rsmsgerrnofiles
|
|
msgid "No files found"
|
|
msgstr "Arquivos não encontrados."
|
|
|
|
#: ulng.rsmsgerrnomemory
|
|
msgid "Not enough memory"
|
|
msgstr "Memória insuficiente."
|
|
|
|
#: ulng.rsmsgerrnotsupported
|
|
msgid "Function not supported!"
|
|
msgstr "Função não suportada!"
|
|
|
|
#: ulng.rsmsgerrorincontextmenucommand
|
|
msgid "Error in context menu command"
|
|
msgstr "Erro no comando do menu contextual."
|
|
|
|
#: ulng.rsmsgerrorloadingconfiguration
|
|
msgid "Error when loading configuration"
|
|
msgstr "Erro ao carregar a configuração."
|
|
|
|
#: ulng.rsmsgerrregexpsyntax
|
|
msgid "Syntax error in regular expression!"
|
|
msgstr "Erro de sintaxe na expressão regular!"
|
|
|
|
#: ulng.rsmsgerrrename
|
|
msgid "Cannot rename file %s to %s"
|
|
msgstr "Impossível renomear o arquivo %s para %s"
|
|
|
|
#: ulng.rsmsgerrsaveassociation
|
|
msgid "Can not save association!"
|
|
msgstr "Impossível salvar associação!"
|
|
|
|
#: ulng.rsmsgerrsavefile
|
|
msgid "Cannot save file"
|
|
msgstr "Impossível Salvar o arquivo."
|
|
|
|
#: ulng.rsmsgerrsetattribute
|
|
msgid "Can not set attributes for \"%s\""
|
|
msgstr "Impossível definir atributos para \"%s\""
|
|
|
|
#: ulng.rsmsgerrsetdatetime
|
|
msgid "Can not set date/time for \"%s\""
|
|
msgstr "Impossível definir data/hora para \"%s\""
|
|
|
|
#: ulng.rsmsgerrsetownership
|
|
msgid "Can not set owner/group for \"%s\""
|
|
msgstr "Impossível definir proprietário/grupo para \"%s\""
|
|
|
|
#: ulng.rsmsgerrsetpermissions
|
|
msgid "Can not set permissions for \"%s\""
|
|
msgstr "Não foi possível definir permissões para \"%s\""
|
|
|
|
#: ulng.rsmsgerrsmallbuf
|
|
msgid "Buffer too small"
|
|
msgstr "Buffer muito pequeno."
|
|
|
|
#: ulng.rsmsgerrtoomanyfiles
|
|
msgid "Too many files to pack"
|
|
msgstr "Muitos arquivos para empacotar."
|
|
|
|
#: ulng.rsmsgerrunknownformat
|
|
msgid "Archive format unknown"
|
|
msgstr "Formato de arquivo desconhecido."
|
|
|
|
#: ulng.rsmsgfavoritetabsdeleteallentries
|
|
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
|
|
msgstr "Tem certeza de que deseja remover todas as entradas de suas guias favoritas? (Não há \"undo\" para esta ação!)"
|
|
|
|
#: ulng.rsmsgfavoritetabsdraghereentry
|
|
msgid "Drag here other entries"
|
|
msgstr "Arraste aqui outras entradas."
|
|
|
|
#: ulng.rsmsgfavoritetabsentername
|
|
msgid "Enter a name this Favorite Tabs entry"
|
|
msgstr "Insira um nome para esta entrada de Tabs Favoritos."
|
|
|
|
#: ulng.rsmsgfavoritetabsenternametitle
|
|
msgid "Saving a new Favorite Tabs entry"
|
|
msgstr "Salvando uma nova entrada Tabs Favoritos."
|
|
|
|
#: ulng.rsmsgfavoritetabsexportedsuccessfully
|
|
msgid "Number of Favorite Tabs exported successfully: %d on %d"
|
|
msgstr "Número de Guias Favoritos exportada com sucesso: %d em %d."
|
|
|
|
#: ulng.rsmsgfavoritetabsextramode
|
|
msgid "Default extra setting for save dir history for new Favorite Tabs:"
|
|
msgstr "Configuração adicional padrão para salvar o histórico de pastas para novas guias favoritas:"
|
|
|
|
#: ulng.rsmsgfavoritetabsimportedsuccessfully
|
|
msgid "Number of file(s) imported successfully: %d on %d"
|
|
msgstr "Número de arquivo(s) importados com sucesso: %d em %d"
|
|
|
|
#: ulng.rsmsgfavoritetabsimportsubmenuname
|
|
msgid "Legacy tabs imported"
|
|
msgstr "Guias legadas importadas"
|
|
|
|
#: ulng.rsmsgfavoritetabsimporttitle
|
|
msgid "Select .tab file(s) to import (could be more than one at the time!)"
|
|
msgstr "Selecione o(s) arquivo(s) .tab para importar (pode ser mais que um ao mesmo tempo)"
|
|
|
|
#: ulng.rsmsgfavoritetabsmodifiednoimport
|
|
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
|
|
msgstr "A última modificação das Guias Gavoritos foi salva. Deseja salvá-las antes de continuar?"
|
|
|
|
#: ulng.rsmsgfavoritetabssimplemode
|
|
msgctxt "ulng.rsmsgfavoritetabssimplemode"
|
|
msgid "Keep saving dir history with Favorite Tabs:"
|
|
msgstr "Manter salvo o histórico de pastas com Guias Favoritos"
|
|
|
|
#: ulng.rsmsgfavoritetabssubmenuname
|
|
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
|
|
msgid "Submenu name"
|
|
msgstr "Nome submenu"
|
|
|
|
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
|
|
msgid "This will load the Favorite Tabs: \"%s\""
|
|
msgstr "Isto irá carregar Guias Favoritos: \"%s\""
|
|
|
|
#: ulng.rsmsgfavortietabssaveoverexisting
|
|
msgid "Save current tabs over existing Favorite Tabs entry"
|
|
msgstr "Salvar as guias atuais sobre a entrada existente de Guias Favoritos"
|
|
|
|
#: ulng.rsmsgfilechangedsave
|
|
msgid "File %s changed, save?"
|
|
msgstr "O arquivo %s foi alterado! Salvar?"
|
|
|
|
#: ulng.rsmsgfileexistsfileinfo
|
|
msgid "%s bytes, %s"
|
|
msgstr "%s bytes, %s"
|
|
|
|
#: ulng.rsmsgfileexistsoverwrite
|
|
msgid "Overwrite:"
|
|
msgstr "Sobreescrever:"
|
|
|
|
#: ulng.rsmsgfileexistsrwrt
|
|
msgid "File %s exists, overwrite?"
|
|
msgstr "O arquivo %s já existe! Substituir?"
|
|
|
|
#: ulng.rsmsgfileexistswithfile
|
|
msgid "With file:"
|
|
msgstr "Com arquivo:"
|
|
|
|
#: ulng.rsmsgfilenotfound
|
|
msgid "File \"%s\" not found."
|
|
msgstr "Arquivo \"%s\" não encontrado"
|
|
|
|
#: ulng.rsmsgfileoperationsactive
|
|
msgid "File operations active"
|
|
msgstr "Operações de arquivo ativas"
|
|
|
|
#: ulng.rsmsgfileoperationsactivelong
|
|
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
|
|
msgstr "Algumas operações de arquivo por terminar. Fechar o Double Commander pode resultar em perda de dados."
|
|
|
|
#: ulng.rsmsgfilepathovermaxpath
|
|
msgid ""
|
|
"The target name length (%d) is more than %d characters!\n"
|
|
"%s\n"
|
|
"Most programs will not be able to access a file/directory with such a long name!\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfilereadonly
|
|
#, fuzzy
|
|
#| msgid "File %s is marked as read-only. Delete it?"
|
|
msgid "File %s is marked as read-only/hidden/system. Delete it?"
|
|
msgstr "O arquivo %s é somente leitura. Quer apagá-lo?"
|
|
|
|
#: ulng.rsmsgfilereloadwarning
|
|
msgid "Are you sure you want to reload the current file and lose the changes?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgfilesizetoobig
|
|
msgid "The file size of \"%s\" is too big for destination file system!"
|
|
msgstr "O tamanho de \"%s\" é muito grande para o sistema de arquivos destino!"
|
|
|
|
#: ulng.rsmsgfolderexistsrwrt
|
|
#, fuzzy
|
|
#| msgid "Folder %s exists, overwrite?"
|
|
msgid "Folder %s exists, merge?"
|
|
msgstr "A pasta %s já existe! Substituir?"
|
|
|
|
#: ulng.rsmsgfollowsymlink
|
|
msgid "Follow symlink \"%s\"?"
|
|
msgstr "Seguir ligação simbólica \"%s\"?"
|
|
|
|
#: ulng.rsmsgfortextformattoimport
|
|
msgid "Select the text format to import"
|
|
msgstr "Selecione o formato do texto a importar"
|
|
|
|
#: ulng.rsmsghotdiraddselecteddirectories
|
|
msgid "Add %d selected dirs"
|
|
msgstr "Adicionar %d pastas selecionadas"
|
|
|
|
#: ulng.rsmsghotdiraddselecteddirectory
|
|
msgid "Add selected dir: "
|
|
msgstr "Adicionar pasta selecionada: "
|
|
|
|
#: ulng.rsmsghotdiraddthisdirectory
|
|
msgid "Add current dir: "
|
|
msgstr "Adicionar pasta atual: "
|
|
|
|
#: ulng.rsmsghotdircommandname
|
|
msgid "Do command"
|
|
msgstr "Executar comando"
|
|
|
|
#: ulng.rsmsghotdircommandsample
|
|
msgid "cm_somthing"
|
|
msgstr "cm_somthing"
|
|
|
|
#: ulng.rsmsghotdirconfighotlist
|
|
msgctxt "ulng.rsmsghotdirconfighotlist"
|
|
msgid "Configuration of Directory Hotlist"
|
|
msgstr "Configuração da Pasta Hotlist"
|
|
|
|
#: ulng.rsmsghotdirdeleteallentries
|
|
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
|
|
msgstr "Tem a certeza de que pretende remover todas as entradas da sua Pasta Hotlist?(não existe \"desfazer\" para esta ação!)"
|
|
|
|
#: ulng.rsmsghotdirdemocommand
|
|
msgid "This will execute the following command:"
|
|
msgstr "Isto irá executar o seguinte comando:"
|
|
|
|
#: ulng.rsmsghotdirdemoname
|
|
msgid "This is hot dir named "
|
|
msgstr "Esta é uma pasta chamada "
|
|
|
|
#: ulng.rsmsghotdirdemopath
|
|
msgid "This will change active frame to the following path:"
|
|
msgstr "Isto irá modificar moldura ativa para o seguinte caminho:"
|
|
|
|
#: ulng.rsmsghotdirdemotarget
|
|
msgid "And inactive frame would change to the following path:"
|
|
msgstr "Uma moldura inativa será alterada para o seguinte caminho:"
|
|
|
|
#: ulng.rsmsghotdirerrorbackuping
|
|
msgid "Error backuping entries..."
|
|
msgstr "Erro ao backupear entradas..."
|
|
|
|
#: ulng.rsmsghotdirerrorexporting
|
|
msgid "Error exporting entries..."
|
|
msgstr "Erro ao exportar entradas..."
|
|
|
|
#: ulng.rsmsghotdirexportall
|
|
msgid "Export all!"
|
|
msgstr "Exportar tudo!"
|
|
|
|
#: ulng.rsmsghotdirexporthotlist
|
|
msgid "Export Directory Hotlist - Select the entries you want to export"
|
|
msgstr "Exportar Pasta Hotlist - Selecione as entradas que você quer exportar."
|
|
|
|
#: ulng.rsmsghotdirexportsel
|
|
msgid "Export selected"
|
|
msgstr "Exportar selecionado"
|
|
|
|
#: ulng.rsmsghotdirimportall
|
|
msgctxt "ulng.rsmsghotdirimportall"
|
|
msgid "Import all!"
|
|
msgstr "Importar tudo!"
|
|
|
|
#: ulng.rsmsghotdirimporthotlist
|
|
msgid "Import Directory Hotlist - Select the entries you want to import"
|
|
msgstr "Importar Pasta Hotlist - Selecione as entradas que você quer exportar."
|
|
|
|
#: ulng.rsmsghotdirimportsel
|
|
msgctxt "ulng.rsmsghotdirimportsel"
|
|
msgid "Import selected"
|
|
msgstr "Importar selecionado"
|
|
|
|
#: ulng.rsmsghotdirjustpath
|
|
msgctxt "ulng.rsmsghotdirjustpath"
|
|
msgid "&Path:"
|
|
msgstr "Caminho"
|
|
|
|
#: ulng.rsmsghotdirlocatehotlistfile
|
|
msgid "Locate \".hotlist\" file to import"
|
|
msgstr "Localizar \".hotlist\" arquivo para importar"
|
|
|
|
#: ulng.rsmsghotdirname
|
|
msgid "Hotdir name"
|
|
msgstr "Nome do Hotdir"
|
|
|
|
#: ulng.rsmsghotdirnbnewentries
|
|
msgid "Number of new entries: %d"
|
|
msgstr "Número de novas entradas: %d"
|
|
|
|
#: ulng.rsmsghotdirnothingtoexport
|
|
msgid "Nothing selected to export!"
|
|
msgstr "Nada selecionado para exportar!"
|
|
|
|
#: ulng.rsmsghotdirpath
|
|
msgid "Hotdir path"
|
|
msgstr "Caminho do HotDir"
|
|
|
|
#: ulng.rsmsghotdirreaddselecteddirectory
|
|
msgid "Re-Add selected dir: "
|
|
msgstr "Readicionar pasta selecionada: "
|
|
|
|
#: ulng.rsmsghotdirreaddthisdirectory
|
|
msgid "Re-Add current dir: "
|
|
msgstr "Readicionar pasta atual: "
|
|
|
|
#: ulng.rsmsghotdirrestorewhat
|
|
msgid "Enter location and filename of Directory Hotlist to restore"
|
|
msgstr "Digite a localização do nome do arquivo da pasta Hotlist para restaurar."
|
|
|
|
#: ulng.rsmsghotdirsimplecommand
|
|
msgctxt "ulng.rsmsghotdirsimplecommand"
|
|
msgid "Command:"
|
|
msgstr "Comando:"
|
|
|
|
#: ulng.rsmsghotdirsimpleendofmenu
|
|
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
|
|
msgid "(end of sub menu)"
|
|
msgstr "(fim do submenu)"
|
|
|
|
#: ulng.rsmsghotdirsimplemenu
|
|
msgctxt "ulng.rsmsghotdirsimplemenu"
|
|
msgid "Menu &name:"
|
|
msgstr "Nome do menu:"
|
|
|
|
#: ulng.rsmsghotdirsimplename
|
|
msgctxt "ulng.rsmsghotdirsimplename"
|
|
msgid "&Name:"
|
|
msgstr "Nome:"
|
|
|
|
#: ulng.rsmsghotdirsimpleseparator
|
|
msgctxt "ulng.rsmsghotdirsimpleseparator"
|
|
msgid "(separator)"
|
|
msgstr "(separador)"
|
|
|
|
#: ulng.rsmsghotdirsubmenuname
|
|
msgctxt "ulng.rsmsghotdirsubmenuname"
|
|
msgid "Submenu name"
|
|
msgstr "Nome submenu"
|
|
|
|
#: ulng.rsmsghotdirtarget
|
|
msgid "Hotdir target"
|
|
msgstr "Destino HotDir"
|
|
|
|
#: ulng.rsmsghotdirtiporderpath
|
|
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
|
|
msgstr "Determine se você deseja que o quadro ativo seja classificado em uma ordem especificada após alterar o diretório"
|
|
|
|
#: ulng.rsmsghotdirtipordertarget
|
|
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
|
|
msgstr "Determine se você deseja que o quadro não ativo seja classificado em uma ordem especificada após alterar o diretório"
|
|
|
|
#: ulng.rsmsghotdirtipspecialdirbut
|
|
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
|
|
msgstr "Algumas funções para selecionar caminho adequado relativo, absoluto, janelas pastas especiais, etc."
|
|
|
|
#: ulng.rsmsghotdirtotalbackuped
|
|
#, fuzzy,badformat
|
|
msgid ""
|
|
"Total entries saved: %d\n"
|
|
"\n"
|
|
"Backup filename: %s\n"
|
|
msgstr ""
|
|
"Total de entradas salvas:% d\n"
|
|
"\n"
|
|
"Nome do arquivo de backup:% s\n"
|
|
|
|
#: ulng.rsmsghotdirtotalexported
|
|
msgid "Total entries exported: "
|
|
msgstr "Total de entradas exportadas: "
|
|
|
|
#: ulng.rsmsghotdirwhattodelete
|
|
msgid ""
|
|
"Do you want to delete all elements inside the sub-menu [%s]?\n"
|
|
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
|
|
msgstr ""
|
|
"Deseja excluir todos os elementos dentro do submenu [%s]?\n"
|
|
"A resposta NÃO irá apagar apenas os delimitadores de menu, mas manterá o elemento dentro do submenu.\n"
|
|
|
|
#: ulng.rsmsghotdirwheretosave
|
|
msgid "Enter location and filename where to save a Directory Hotlist file"
|
|
msgstr "Insira a localização eo nome do arquivo onde salvar um arquivo na pasta HotList"
|
|
|
|
#: ulng.rsmsgincorrectfilelength
|
|
msgid "Incorrect resulting filelength for file : \"%s\""
|
|
msgstr "Comprimento de arquivo resultante incorreto para arquivo: \"%s\""
|
|
|
|
#: ulng.rsmsginsertnextdisk
|
|
msgid ""
|
|
"Please insert next disk or something similar.\n"
|
|
"\n"
|
|
"It is to allow writing this file:\n"
|
|
"\"%s\"\n"
|
|
"\n"
|
|
"Number of bytes still to write: %d\n"
|
|
msgstr ""
|
|
"Por favor, insira o próximo disco ou algo similar.\n"
|
|
"\n"
|
|
"É para permitir escrever este arquivo: \n"
|
|
"\"%s\"\n"
|
|
"\n"
|
|
"Número de bytes ainda a escrever:%d\n"
|
|
|
|
#: ulng.rsmsginvalidcommandline
|
|
msgid "Error in command line"
|
|
msgstr "Erro na linha de comandos"
|
|
|
|
#: ulng.rsmsginvalidfilename
|
|
msgid "Invalid filename"
|
|
msgstr "Nome de arquivo inválido"
|
|
|
|
#: ulng.rsmsginvalidformatofconfigurationfile
|
|
msgid "Invalid format of configuration file"
|
|
msgstr "Formato do arquivo de configuração inválido"
|
|
|
|
#: ulng.rsmsginvalidhexnumber
|
|
msgid "Invalid hexadecimal number: \"%s\""
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsginvalidpath
|
|
msgid "Invalid path"
|
|
msgstr "Caminho inválido"
|
|
|
|
#: ulng.rsmsginvalidpathlong
|
|
msgid "Path %s contains forbidden characters."
|
|
msgstr "O caminho %s contém caracteres proibidos."
|
|
|
|
#: ulng.rsmsginvalidplugin
|
|
msgid "This is not a valid plugin!"
|
|
msgstr "Este não é um suplemento válido!"
|
|
|
|
#: ulng.rsmsginvalidpluginarchitecture
|
|
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
|
|
msgstr "Este suplemento é feito para o Double Commander para %s. %s não pode trabalhar com o Double Commander para %s!"
|
|
|
|
#: ulng.rsmsginvalidquoting
|
|
msgid "Invalid quoting"
|
|
msgstr "Aspas inválidas"
|
|
|
|
#: ulng.rsmsginvalidselection
|
|
msgid "Invalid selection."
|
|
msgstr "Seleção inválida."
|
|
|
|
#: ulng.rsmsgloadingfilelist
|
|
msgid "Loading file list..."
|
|
msgstr "Carregando a lista de arquivos..."
|
|
|
|
#: ulng.rsmsglocatetcconfiguation
|
|
msgid "Locate TC configuration file (wincmd.ini)"
|
|
msgstr "Localizar o arquivo de configuração do TC (wincmd.ini)"
|
|
|
|
#: ulng.rsmsglocatetcexecutable
|
|
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
|
|
msgstr "Localizar arquivo executável TC (totalcmd.exe ou totalcmd64.exe)"
|
|
|
|
#: ulng.rsmsglogcopy
|
|
msgid "Copy file %s"
|
|
msgstr "Copiar arquivo %s"
|
|
|
|
#: ulng.rsmsglogdelete
|
|
msgid "Delete file %s"
|
|
msgstr "Excluir arquivo %s"
|
|
|
|
#: ulng.rsmsglogerror
|
|
msgid "Error: "
|
|
msgstr "Erro:"
|
|
|
|
#: ulng.rsmsglogextcmdlaunch
|
|
msgid "Launch external"
|
|
msgstr "Carregar externo"
|
|
|
|
#: ulng.rsmsglogextcmdresult
|
|
msgid "Result external"
|
|
msgstr "Resultado externo"
|
|
|
|
#: ulng.rsmsglogextract
|
|
msgid "Extract file %s"
|
|
msgstr "Extrair arquivo %s"
|
|
|
|
#: ulng.rsmsgloginfo
|
|
msgid "Info: "
|
|
msgstr "Informação:"
|
|
|
|
#: ulng.rsmsgloglink
|
|
msgid "Create link %s"
|
|
msgstr "Criar ligação %s"
|
|
|
|
#: ulng.rsmsglogmkdir
|
|
msgid "Create directory %s"
|
|
msgstr "Criar pasta %s"
|
|
|
|
#: ulng.rsmsglogmove
|
|
msgid "Move file %s"
|
|
msgstr "Mover arquivo %s"
|
|
|
|
#: ulng.rsmsglogpack
|
|
msgid "Pack to file %s"
|
|
msgstr "Comprimir para arquivo %s"
|
|
|
|
#: ulng.rsmsglogrmdir
|
|
msgid "Remove directory %s"
|
|
msgstr "Remover pasta %s"
|
|
|
|
#: ulng.rsmsglogsuccess
|
|
msgid "Done: "
|
|
msgstr "Feito:"
|
|
|
|
#: ulng.rsmsglogsymlink
|
|
msgid "Create symlink %s"
|
|
msgstr "Criar ligação simbólica %s"
|
|
|
|
#: ulng.rsmsglogtest
|
|
msgid "Test file integrity %s"
|
|
msgstr "Testar integridade do arquivo %s"
|
|
|
|
#: ulng.rsmsglogwipe
|
|
msgid "Wipe file %s"
|
|
msgstr "Limpar arquivo %s"
|
|
|
|
#: ulng.rsmsglogwipedir
|
|
msgid "Wipe directory %s"
|
|
msgstr "Limpar pasta %s"
|
|
|
|
#: ulng.rsmsgmasterpassword
|
|
msgid "Master Password"
|
|
msgstr "Senha Mestra"
|
|
|
|
#: ulng.rsmsgmasterpasswordenter
|
|
msgid "Please enter the master password:"
|
|
msgstr "Por favor introduza senha mestra:"
|
|
|
|
#: ulng.rsmsgnewfile
|
|
msgid "New file"
|
|
msgstr "Novo arquivo"
|
|
|
|
#: ulng.rsmsgnextvolunpack
|
|
msgid "Next volume will be unpacked"
|
|
msgstr "O próximo volume será descomprimido"
|
|
|
|
#: ulng.rsmsgnofiles
|
|
msgid "No files"
|
|
msgstr "Sem arquivos"
|
|
|
|
#: ulng.rsmsgnofilesselected
|
|
msgid "No files selected."
|
|
msgstr "Sem arquivos selecionados"
|
|
|
|
#: ulng.rsmsgnofreespacecont
|
|
msgid "No enough free space on target drive, Continue?"
|
|
msgstr "Não há espaço suficiente no destino! Continuar?"
|
|
|
|
#: ulng.rsmsgnofreespaceretry
|
|
msgid "No enough free space on target drive, Retry?"
|
|
msgstr "Não há espaço suficiente no destino! Tentar novamente?"
|
|
|
|
#: ulng.rsmsgnotdelete
|
|
msgid "Can not delete file %s"
|
|
msgstr "Impossível Excluir o arquivo %s"
|
|
|
|
#: ulng.rsmsgnotimplemented
|
|
msgid "Not implemented."
|
|
msgstr "Não implementado."
|
|
|
|
#: ulng.rsmsgobjectnotexists
|
|
msgid "Object does not exist!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgpanelpreview
|
|
msgctxt "ulng.rsmsgpanelpreview"
|
|
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
|
|
msgstr "Abaixo está uma pré-visualização. Você pode mover o cursor e selecionar arquivos para obter imediatamente uma aparência real das várias configurações."
|
|
|
|
#: ulng.rsmsgpassword
|
|
msgid "Password:"
|
|
msgstr "Senha:"
|
|
|
|
#: ulng.rsmsgpassworddiff
|
|
msgid "Passwords are different!"
|
|
msgstr "As senhas são diferentes!"
|
|
|
|
#: ulng.rsmsgpasswordenter
|
|
msgid "Please enter the password:"
|
|
msgstr "Por favor introduza a senha:"
|
|
|
|
#: ulng.rsmsgpasswordfirewall
|
|
msgid "Password (Firewall):"
|
|
msgstr "Senha (Firewall):"
|
|
|
|
#: ulng.rsmsgpasswordverify
|
|
msgid "Please re-enter the password for verification:"
|
|
msgstr "Por favor reintroduza a senha para verificação:"
|
|
|
|
#: ulng.rsmsgpopuphotdelete
|
|
msgid "&Delete %s"
|
|
msgstr "&Excluir %s"
|
|
|
|
#: ulng.rsmsgpresetalreadyexists
|
|
msgid "Preset \"%s\" already exists. Overwrite?"
|
|
msgstr "Predefinição \"%s\" já existe! Substituir?"
|
|
|
|
#: ulng.rsmsgproblemexecutingcommand
|
|
msgid "Problem executing command (%s)"
|
|
msgstr "Problema ao executar comando (%s)"
|
|
|
|
#: ulng.rsmsgpromptaskingfilename
|
|
msgid "Filename for dropped text:"
|
|
msgstr "Nome do arquivo para o texto descartado:"
|
|
|
|
#: ulng.rsmsgprovidethisfile
|
|
msgid "Please, make this file available. Retry?"
|
|
msgstr "Por favor, disponibilize este arquivo. Repetir?"
|
|
|
|
#: ulng.rsmsgrenamefavtabs
|
|
msgid "Enter new friendly name for this Favorite Tabs"
|
|
msgstr "Digite um novo nome amigável para esta Guia Favoritos"
|
|
|
|
#: ulng.rsmsgrenamefavtabsmenu
|
|
msgid "Enter new name for this menu"
|
|
msgstr "Digite novo nome para este menu"
|
|
|
|
#: ulng.rsmsgrenfldr
|
|
msgid "Rename/move %d selected files/directories?"
|
|
msgstr "Renomear/Mover %d arquivos/pastas selecionados?"
|
|
|
|
#: ulng.rsmsgrensel
|
|
msgid "Rename/move selected \"%s\"?"
|
|
msgstr "Renomear/Mover \"%s\" selecionados?"
|
|
|
|
#: ulng.rsmsgrestartforapplychanges
|
|
msgid "Please, restart Double Commander in order to apply changes"
|
|
msgstr "Por favor reinicie o Double Commander para aplicar as alterações"
|
|
|
|
#: ulng.rsmsgsekectfiletype
|
|
msgid "Select to which file type to add extension \"%s\""
|
|
msgstr "Selecione o tipo de arquivo para adicionar a extensão \"%s\""
|
|
|
|
#: ulng.rsmsgselectedinfo
|
|
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
|
|
msgstr "Selecionados: %s de %s, arquivos: %d de %d, pastas: %d de %d"
|
|
|
|
#: ulng.rsmsgselectexecutablefile
|
|
msgid "Select executable file for"
|
|
msgstr "Selecionar arquivo executável para"
|
|
|
|
#: ulng.rsmsgselectonlychecksumfiles
|
|
msgid "Please select only checksum files!"
|
|
msgstr "Por favor, selecione só arquivos checksum"
|
|
|
|
#: ulng.rsmsgsellocnextvol
|
|
msgid "Please select location of next volume"
|
|
msgstr "Por favor, selecione a localização do próximo volume"
|
|
|
|
#: ulng.rsmsgsetvolumelabel
|
|
msgid "Set volume label"
|
|
msgstr "Definir rótulo do volume"
|
|
|
|
#: ulng.rsmsgspecialdir
|
|
msgid "Special Dirs"
|
|
msgstr "Pastas Especiais"
|
|
|
|
#: ulng.rsmsgspecialdiraddacti
|
|
msgid "Add path from active frame"
|
|
msgstr "Adicionar caminho para a moldura ativa"
|
|
|
|
#: ulng.rsmsgspecialdiraddnonacti
|
|
msgid "Add path from inactive frame"
|
|
msgstr "Adicionar caminho para a moldura inativa"
|
|
|
|
#: ulng.rsmsgspecialdirbrowssel
|
|
msgid "Browse and use selected path"
|
|
msgstr "Navegar e usar caminho selecionado."
|
|
|
|
#: ulng.rsmsgspecialdirenvvar
|
|
msgid "Use environment variable..."
|
|
msgstr "Usar variável de ambiente..."
|
|
|
|
#: ulng.rsmsgspecialdirgotodc
|
|
msgid "Go to Double Commander special path..."
|
|
msgstr "Vá para caminho especial do Double Commander..."
|
|
|
|
#: ulng.rsmsgspecialdirgotoenvvar
|
|
msgid "Go to environment variable..."
|
|
msgstr "Vá para variável de ambiente..."
|
|
|
|
#: ulng.rsmsgspecialdirgotoother
|
|
msgid "Go to other Windows special folder..."
|
|
msgstr "Vá para pasta especial do Windows..."
|
|
|
|
#: ulng.rsmsgspecialdirgototc
|
|
msgid "Go to Windows special folder (TC)..."
|
|
msgstr "Vá para pasta especial (TC)..."
|
|
|
|
#: ulng.rsmsgspecialdirmakereltohotdir
|
|
msgid "Make relative to hotdir path"
|
|
msgstr "Fazer caminho relativo para hotdir"
|
|
|
|
#: ulng.rsmsgspecialdirmkabso
|
|
msgid "Make path absolute"
|
|
msgstr "Tornar caminho absoluto"
|
|
|
|
#: ulng.rsmsgspecialdirmkdcrel
|
|
msgid "Make relative to Double Commander special path..."
|
|
msgstr "Tornar relativo o caminho especial para Double Commander"
|
|
|
|
#: ulng.rsmsgspecialdirmkenvrel
|
|
msgid "Make relative to environment variable..."
|
|
msgstr "Tornar relativa a variável de ambiente..."
|
|
|
|
#: ulng.rsmsgspecialdirmktctel
|
|
msgid "Make relative to Windows special folder (TC)..."
|
|
msgstr "Tornar relativo a pasta especial do Windows (TC)..."
|
|
|
|
#: ulng.rsmsgspecialdirmkwnrel
|
|
msgid "Make relative to other Windows special folder..."
|
|
msgstr "Tornar relativo a outra pasta especial do Windows..."
|
|
|
|
#: ulng.rsmsgspecialdirusedc
|
|
msgid "Use Double Commander special path..."
|
|
msgstr "Usar caminho especial do Double Commander"
|
|
|
|
#: ulng.rsmsgspecialdirusehotdir
|
|
msgid "Use hotdir path"
|
|
msgstr "Usar caminho hotdir"
|
|
|
|
#: ulng.rsmsgspecialdiruseother
|
|
msgid "Use other Windows special folder..."
|
|
msgstr "Usar outra pasta especial do Windows..."
|
|
|
|
#: ulng.rsmsgspecialdirusetc
|
|
msgid "Use Windows special folder (TC)..."
|
|
msgstr "Use a pasta especial do Windows (TC)..."
|
|
|
|
#: ulng.rsmsgtabforopeninginnewtab
|
|
msgid "This tab (%s) is locked! Open directory in another tab?"
|
|
msgstr "Esta guia (%s) está bloqueada! Abrir pasta em outra guia?"
|
|
|
|
#: ulng.rsmsgtabrenamecaption
|
|
msgid "Rename tab"
|
|
msgstr "Renomear guia"
|
|
|
|
#: ulng.rsmsgtabrenameprompt
|
|
msgid "New tab name:"
|
|
msgstr "Novo nome da guia:"
|
|
|
|
#: ulng.rsmsgtargetdir
|
|
msgid "Target path:"
|
|
msgstr "Caminho destino:"
|
|
|
|
#: ulng.rsmsgtcconfignotfound
|
|
msgid ""
|
|
"Error! Cannot find the TC configuration file:\n"
|
|
"%s\n"
|
|
msgstr ""
|
|
"Erro! Não é possível encontrar o arquivo de configuração do TC:\n"
|
|
"%s\n"
|
|
|
|
#: ulng.rsmsgtcexecutablenotfound
|
|
msgid ""
|
|
"Error! Cannot find the TC configuration executable:\n"
|
|
"%s\n"
|
|
msgstr ""
|
|
"Erro! Não é possível encontrar o executável de configuração do TC:\n"
|
|
"%s\n"
|
|
|
|
#: ulng.rsmsgtcisrunning
|
|
msgid ""
|
|
"Error! TC is still running but it should be closed for this operation.\n"
|
|
"Close it and press OK or press CANCEL to abort.\n"
|
|
msgstr ""
|
|
"Erro! TC ainda está em execução, mas deve ser fechado para esta operação.\n"
|
|
"Feche-o e pressione OK ou pressione CANCELAR para cancelar.\n"
|
|
|
|
#: ulng.rsmsgtctoolbarnotfound
|
|
msgid ""
|
|
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
|
|
"%s\n"
|
|
msgstr ""
|
|
"Erro! Não é possível encontrar a pasta de saída desejada da barra de ferramentas TC:\n"
|
|
"%s\n"
|
|
|
|
#: ulng.rsmsgtctoolbarwheretosave
|
|
msgid "Enter location and filename where to save a TC Toolbar file"
|
|
msgstr "Digite a localização e o nome do arquivo onde salvar um arquivo da barra de ferramentas do TC"
|
|
|
|
#: ulng.rsmsgthisisnowinclipboard
|
|
msgid "\"%s\" is now in the clipboard"
|
|
msgstr "\"%s\" está agora na àrea de Transferência"
|
|
|
|
#: ulng.rsmsgtitleextnotinfiletype
|
|
msgid "Extension of selected file is not in any recognized file types"
|
|
msgstr "Extensão do arquivo selecionado não está em nenhum tipo de arquivo reconhecido"
|
|
|
|
#: ulng.rsmsgtoolbarlocatedctoolbarfile
|
|
msgid "Locate \".toolbar\" file to import"
|
|
msgstr "Localizar o arquivo \".toolbar\" para importar"
|
|
|
|
#: ulng.rsmsgtoolbarlocatetctoolbarfile
|
|
msgid "Locate \".BAR\" file to import"
|
|
msgstr "Localizar o arquivo \".BAR\" para importar"
|
|
|
|
#: ulng.rsmsgtoolbarrestorewhat
|
|
msgid "Enter location and filename of Toolbar to restore"
|
|
msgstr "Digite localização e nome arquivo da Barra Ferramenta para restaurar"
|
|
|
|
#: ulng.rsmsgtoolbarsaved
|
|
msgid ""
|
|
"Saved!\n"
|
|
"Toolbar filename: %s\n"
|
|
msgstr ""
|
|
"Salvo!\n"
|
|
"Nome arq Barra Ferramenta: %s\n"
|
|
|
|
#: ulng.rsmsgtoomanyfilesselected
|
|
msgid "Too many files selected."
|
|
msgstr "Muitos arquivos selecionados."
|
|
|
|
#: ulng.rsmsgundeterminednumberoffile
|
|
msgid "Undetermined"
|
|
msgstr "Indeterminado:"
|
|
|
|
#: ulng.rsmsgunexpectedusagetreeviewmenu
|
|
msgid "ERROR: Unexpected Tree View Menu usage!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgurl
|
|
msgid "URL:"
|
|
msgstr "URL:"
|
|
|
|
#: ulng.rsmsguserdidnotsetextension
|
|
msgid "<NO EXT>"
|
|
msgstr "<SEM EXT>"
|
|
|
|
#: ulng.rsmsguserdidnotsetname
|
|
msgid "<NO NAME>"
|
|
msgstr "<SEM NOME>"
|
|
|
|
#: ulng.rsmsgusername
|
|
msgid "User name:"
|
|
msgstr "Nome de usuário"
|
|
|
|
#: ulng.rsmsgusernamefirewall
|
|
msgid "User name (Firewall):"
|
|
msgstr "Nome de usuário (Firewall):"
|
|
|
|
#: ulng.rsmsgverify
|
|
msgid "VERIFICATION:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgverifywrong
|
|
msgid "The target file is corrupted, checksum mismatch!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmsgvolumelabel
|
|
msgid "Volume label:"
|
|
msgstr "Rótulo do volume:"
|
|
|
|
#: ulng.rsmsgvolumesizeenter
|
|
msgid "Please enter the volume size:"
|
|
msgstr "Por favor, introduza o tamanho do volume:"
|
|
|
|
#: ulng.rsmsgwipefldr
|
|
msgid "Wipe %d selected files/directories?"
|
|
msgstr "Limpar %d arquivos/pastas selecionados?"
|
|
|
|
#: ulng.rsmsgwipesel
|
|
#, fuzzy,badformat
|
|
msgid "Wipe selected \"%s\"?"
|
|
msgstr "Limpar \"s\" selecionados?"
|
|
|
|
#: ulng.rsmsgwithactionwith
|
|
msgid "with"
|
|
msgstr "largura"
|
|
|
|
#: ulng.rsmsgwrongpasswordtryagain
|
|
msgid ""
|
|
"Wrong password!\n"
|
|
"Please try again!\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmulrenautorename
|
|
msgid "Do auto-rename to \"name (1).ext\", \"name (2).ext\" etc.?"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmulrenfilenamestylelist
|
|
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
|
|
msgstr "Sem alteração;MAIÚSCULAS;minúsculas;Primeira maiúscula;Primeira De Todas As Palavras Maiúscula;"
|
|
|
|
#: ulng.rsmulrenwarningduplicate
|
|
msgid "Warning, duplicate names!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsmulrenwronglinesnumber
|
|
msgid "File contains wrong number of lines: %d, should be %d!"
|
|
msgstr ""
|
|
|
|
#: ulng.rsnewsearchclearfilteroptions
|
|
msgid "Keep;Clear;Prompt"
|
|
msgstr ""
|
|
|
|
#: ulng.rsnoequivalentinternalcommand
|
|
msgid "No internal equivalent command"
|
|
msgstr ""
|
|
|
|
#: ulng.rsnofindfileswindowyet
|
|
msgid "Sorry, no \"Find files\" window yet..."
|
|
msgstr ""
|
|
|
|
#: ulng.rsnootherfindfileswindowtoclose
|
|
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithdevelopment
|
|
msgid "Development"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwitheducation
|
|
msgid "Education"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithgames
|
|
msgid "Games"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithgraphics
|
|
#, fuzzy
|
|
msgctxt "ulng.rsopenwithgraphics"
|
|
msgid "Graphics"
|
|
msgstr "Gráficos"
|
|
|
|
#: ulng.rsopenwithmultimedia
|
|
msgid "Multimedia"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithnetwork
|
|
#, fuzzy
|
|
msgctxt "ulng.rsopenwithnetwork"
|
|
msgid "Network"
|
|
msgstr "Rede"
|
|
|
|
#: ulng.rsopenwithoffice
|
|
msgid "Office"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithother
|
|
#, fuzzy
|
|
msgctxt "ulng.rsopenwithother"
|
|
msgid "Other"
|
|
msgstr "Outro"
|
|
|
|
#: ulng.rsopenwithscience
|
|
msgid "Science"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithsettings
|
|
msgid "Settings"
|
|
msgstr ""
|
|
|
|
#: ulng.rsopenwithsystem
|
|
#, fuzzy
|
|
msgctxt "ulng.rsopenwithsystem"
|
|
msgid "System"
|
|
msgstr "Sistema"
|
|
|
|
#: ulng.rsopenwithutility
|
|
msgid "Accessories"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoperaborted
|
|
msgid "Aborted"
|
|
msgstr "Abortado"
|
|
|
|
#: ulng.rsopercalculatingchecksum
|
|
#, fuzzy
|
|
msgctxt "ulng.rsopercalculatingchecksum"
|
|
msgid "Calculating checksum"
|
|
msgstr "Calculando a checksum"
|
|
|
|
#: ulng.rsopercalculatingchecksumin
|
|
msgid "Calculating checksum in \"%s\""
|
|
msgstr "Calculando a checksum em \"%s\""
|
|
|
|
#: ulng.rsopercalculatingchecksumof
|
|
#, fuzzy
|
|
msgctxt "ulng.rsopercalculatingchecksumof"
|
|
msgid "Calculating checksum of \"%s\""
|
|
msgstr "Calculando a checksum de \"%s\""
|
|
|
|
#: ulng.rsopercalculatingstatictics
|
|
msgctxt "ulng.rsopercalculatingstatictics"
|
|
msgid "Calculating"
|
|
msgstr "Calculando"
|
|
|
|
#: ulng.rsopercalculatingstatisticsin
|
|
msgid "Calculating \"%s\""
|
|
msgstr "Calculando \"%s\""
|
|
|
|
#: ulng.rsopercombining
|
|
msgid "Joining"
|
|
msgstr "Juntando"
|
|
|
|
#: ulng.rsopercombiningfromto
|
|
msgid "Joining files in \"%s\" to \"%s\""
|
|
msgstr "Juntando arquivos em \"%s\" para \"%s\""
|
|
|
|
#: ulng.rsopercopying
|
|
msgid "Copying"
|
|
msgstr "Copiando"
|
|
|
|
#: ulng.rsopercopyingfromto
|
|
msgid "Copying from \"%s\" to \"%s\""
|
|
msgstr "Copiando de \"%s\" para \"%s\""
|
|
|
|
#: ulng.rsopercopyingsomethingto
|
|
msgid "Copying \"%s\" to \"%s\""
|
|
msgstr "copiar \"%s\" para \"%s\""
|
|
|
|
#: ulng.rsopercreatingdirectory
|
|
msgid "Creating directory"
|
|
msgstr "Criando pasta"
|
|
|
|
#: ulng.rsopercreatingsomedirectory
|
|
msgid "Creating directory \"%s\""
|
|
msgstr "Criando pasta \"%s\""
|
|
|
|
#: ulng.rsoperdeleting
|
|
msgctxt "ulng.rsoperdeleting"
|
|
msgid "Deleting"
|
|
msgstr "Excluindo"
|
|
|
|
#: ulng.rsoperdeletingin
|
|
msgid "Deleting in \"%s\""
|
|
msgstr "Excluindo em \"%s\""
|
|
|
|
#: ulng.rsoperdeletingsomething
|
|
msgid "Deleting \"%s\""
|
|
msgstr "Excluindo \"%s\""
|
|
|
|
#: ulng.rsoperexecuting
|
|
msgid "Executing"
|
|
msgstr "Executando"
|
|
|
|
#: ulng.rsoperexecutingsomething
|
|
msgid "Executing \"%s\""
|
|
msgstr "Executando \"%s\""
|
|
|
|
#: ulng.rsoperextracting
|
|
msgid "Extracting"
|
|
msgstr "Extraindo"
|
|
|
|
#: ulng.rsoperextractingfromto
|
|
msgid "Extracting from \"%s\" to \"%s\""
|
|
msgstr "Extraindo de \"%s\" para \"%s\""
|
|
|
|
#: ulng.rsoperfinished
|
|
msgid "Finished"
|
|
msgstr "Terminado"
|
|
|
|
#: ulng.rsoperlisting
|
|
msgid "Listing"
|
|
msgstr "Listando"
|
|
|
|
#: ulng.rsoperlistingin
|
|
msgid "Listing \"%s\""
|
|
msgstr "Listando \"%s\""
|
|
|
|
#: ulng.rsopermoving
|
|
msgid "Moving"
|
|
msgstr "Movendo"
|
|
|
|
#: ulng.rsopermovingfromto
|
|
msgid "Moving from \"%s\" to \"%s\""
|
|
msgstr "Movendo de \"%s\" para \"%s\""
|
|
|
|
#: ulng.rsopermovingsomethingto
|
|
msgid "Moving \"%s\" to \"%s\""
|
|
msgstr "Movendo \"%s\" para \"%s\""
|
|
|
|
#: ulng.rsopernotstarted
|
|
msgid "Not started"
|
|
msgstr "Não iniciado"
|
|
|
|
#: ulng.rsoperpacking
|
|
msgid "Packing"
|
|
msgstr "Comprimindo"
|
|
|
|
#: ulng.rsoperpackingfromto
|
|
msgid "Packing from \"%s\" to \"%s\""
|
|
msgstr "Comprimindo de \"%s\" para \"%s\""
|
|
|
|
#: ulng.rsoperpackingsomethingto
|
|
msgid "Packing \"%s\" to \"%s\""
|
|
msgstr "Comprimindo \"%s\" para \"%s\""
|
|
|
|
#: ulng.rsoperpaused
|
|
msgid "Paused"
|
|
msgstr "Pausado"
|
|
|
|
#: ulng.rsoperpausing
|
|
msgid "Pausing"
|
|
msgstr "Pausando"
|
|
|
|
#: ulng.rsoperrunning
|
|
msgid "Running"
|
|
msgstr "Executando"
|
|
|
|
#: ulng.rsopersettingproperty
|
|
msgid "Setting property"
|
|
msgstr "Definir propriedade"
|
|
|
|
#: ulng.rsopersettingpropertyin
|
|
msgid "Setting property in \"%s\""
|
|
msgstr "Definir propriedade em \"%s\""
|
|
|
|
#: ulng.rsopersettingpropertyof
|
|
msgid "Setting property of \"%s\""
|
|
msgstr "Definir propriedade de \"%s\""
|
|
|
|
#: ulng.rsopersplitting
|
|
msgid "Splitting"
|
|
msgstr "Dividindo"
|
|
|
|
#: ulng.rsopersplittingfromto
|
|
msgid "Splitting \"%s\" to \"%s\""
|
|
msgstr "Dividindo \"%s\" para \"%s\""
|
|
|
|
#: ulng.rsoperstarting
|
|
msgid "Starting"
|
|
msgstr "Iniciando"
|
|
|
|
#: ulng.rsoperstopped
|
|
msgid "Stopped"
|
|
msgstr "Parado"
|
|
|
|
#: ulng.rsoperstopping
|
|
msgid "Stopping"
|
|
msgstr "Parando"
|
|
|
|
#: ulng.rsopertesting
|
|
msgid "Testing"
|
|
msgstr "Testando"
|
|
|
|
#: ulng.rsopertestingin
|
|
msgid "Testing in \"%s\""
|
|
msgstr "Testando em \"%s\""
|
|
|
|
#: ulng.rsopertestingsomething
|
|
msgid "Testing \"%s\""
|
|
msgstr "Testando \"%s\""
|
|
|
|
#: ulng.rsoperverifyingchecksum
|
|
msgid "Verifying checksum"
|
|
msgstr "Verificando checksum"
|
|
|
|
#: ulng.rsoperverifyingchecksumin
|
|
msgid "Verifying checksum in \"%s\""
|
|
msgstr "Verificando checksum em \"%s\""
|
|
|
|
#: ulng.rsoperverifyingchecksumof
|
|
#, fuzzy
|
|
msgctxt "ulng.rsoperverifyingchecksumof"
|
|
msgid "Verifying checksum of \"%s\""
|
|
msgstr "Verificando checksum de \"%s\""
|
|
|
|
#: ulng.rsoperwaitingforconnection
|
|
msgid "Waiting for access to file source"
|
|
msgstr "Aguardando acesso à origem do arquivo"
|
|
|
|
#: ulng.rsoperwaitingforfeedback
|
|
msgid "Waiting for user response"
|
|
msgstr "Aguardando resposta do usuário"
|
|
|
|
#: ulng.rsoperwiping
|
|
msgid "Wiping"
|
|
msgstr "Limpando"
|
|
|
|
#: ulng.rsoperwipingin
|
|
msgid "Wiping in \"%s\""
|
|
msgstr "Limpando em \"%s\""
|
|
|
|
#: ulng.rsoperwipingsomething
|
|
msgid "Wiping \"%s\""
|
|
msgstr "Limpando \"%s\""
|
|
|
|
#: ulng.rsoperworking
|
|
msgid "Working"
|
|
msgstr "Trabalhando"
|
|
|
|
#: ulng.rsoptaddfrommainpanel
|
|
msgid "Add at &beginning;Add at the end;Smart add"
|
|
msgstr "Adicionar no início; Adicionar no final; Smart adicionar"
|
|
|
|
#: ulng.rsoptarchiveconfiguresavetochange
|
|
msgid "To change current editing archive configuration, either APPLY or DELETE current editing one"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiveradditonalcmd
|
|
msgid "Mode dependent, additional command"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiveraddonlynotempty
|
|
msgid "Add if it is non-empty"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverarchivel
|
|
msgid "Archive File (long name)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverarchiver
|
|
msgid "Select archiver executable"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverarchives
|
|
msgid "Archive file (short name)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverchangeencoding
|
|
msgid "Change Archiver Listing Encoding"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverconfirmdelete
|
|
msgid "Are you sure you want to delete: %s"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverdefaultexportfilename
|
|
msgid "Exported Archiver Configuration"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchivererrorlevel
|
|
msgid "errorlevel"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverexportcaption
|
|
msgid "Export archiver configuration"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverexportdone
|
|
msgid "Exportation of %d elements to file \"%s\" completed."
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverexportprompt
|
|
msgid "Select the one(s) you want to export"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverfilelistl
|
|
msgid "Filelist (long names)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverfilelists
|
|
msgid "Filelist (short names)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverimportcaption
|
|
msgid "Import archiver configuration"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverimportdone
|
|
msgid "Importation of %d elements from file \"%s\" completed."
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverimportfile
|
|
msgid "Select the file to import archiver configuration(s)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverimportprompt
|
|
msgid "Select the one(s) you want to import"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverjustname
|
|
msgid "Use name only, without path"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverjustpath
|
|
msgid "Use path only, without name"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverprograml
|
|
msgid "Archive Program (long name)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverprograms
|
|
msgid "Archive Program (short name)"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverquoteall
|
|
msgid "Quote all names"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverquotewithspace
|
|
msgid "Quote names with spaces"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiversinglefprocess
|
|
msgid "Single filename to process"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchivertargetsubdir
|
|
msgid "Target subdirecory"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiveruseansi
|
|
msgid "Use ANSI encoding"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiveruseutf8
|
|
msgid "Use UTF8 encoding"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchiverwheretosave
|
|
msgid "Enter location and filename where to save archiver configuration"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptarchivetypename
|
|
msgid "Archive type name:"
|
|
msgstr "Nome do tipo de arquivo:"
|
|
|
|
#: ulng.rsoptassocpluginwith
|
|
msgid "Associate plugin \"%s\" with:"
|
|
msgstr "Associar suplemento \"%s\" com:"
|
|
|
|
#: ulng.rsoptautosizecolumn
|
|
msgid "First;Last;"
|
|
msgstr "Primeiro;Último;"
|
|
|
|
#: ulng.rsoptconfigsortorder
|
|
msgid "Classic, legacy order;Alphabetic order (but language still first)"
|
|
msgstr "Clássico, ordem do legado, ordem alfabética (mas a idioma primeiro.)"
|
|
|
|
#: ulng.rsoptdifferframeposition
|
|
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
|
|
msgstr "Painel de quadro ativo à esquerda, inativo à direita (legado).; Painel de quadro esquerdo à esquerda, direito à direita."
|
|
|
|
#: ulng.rsoptdisable
|
|
msgid "Disable"
|
|
msgstr "Desativar"
|
|
|
|
#: ulng.rsoptenable
|
|
msgctxt "ulng.rsoptenable"
|
|
msgid "Enable"
|
|
msgstr "Ativar"
|
|
|
|
#: ulng.rsoptenterext
|
|
msgid "Enter extension"
|
|
msgstr "Introduza extensão"
|
|
|
|
#: ulng.rsoptfavoritetabswheretoaddinlist
|
|
msgid "Add at beginning;Add at the end;Alphabetical sort"
|
|
msgstr "Adicionar no início;Adicionar no final;Ordenação alfabética"
|
|
|
|
#: ulng.rsoptfileoperationsprogresskind
|
|
msgid "separate window;minimized separate window;operations panel"
|
|
msgstr "janela separada;janela separada minimizada;painel de operações"
|
|
|
|
#: ulng.rsoptfilesizeformat
|
|
msgid "float;B;K;M;G"
|
|
msgstr "flutuante;B;K;M;G"
|
|
|
|
#: ulng.rsopthotkeysadddeleteshortcutlong
|
|
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
|
|
msgstr "Atalho %s para cm_Delete será registado, pelo que poderá ser usado para reverter esta definição."
|
|
|
|
#: ulng.rsopthotkeysaddhotkey
|
|
msgid "Add hotkey for %s"
|
|
msgstr "Adicionar atalho para %s"
|
|
|
|
#: ulng.rsopthotkeysaddshortcutbutton
|
|
msgid "Add shortcut"
|
|
msgstr "Adicionar atalho"
|
|
|
|
#: ulng.rsopthotkeyscannotsetshortcut
|
|
msgid "Cannot set shortcut"
|
|
msgstr "Impossível definir atalho"
|
|
|
|
#: ulng.rsopthotkeyschangeshortcut
|
|
msgid "Change shortcut"
|
|
msgstr "Alterar atalho"
|
|
|
|
#: ulng.rsopthotkeyscommand
|
|
msgctxt "ulng.rsopthotkeyscommand"
|
|
msgid "Command"
|
|
msgstr "Commando"
|
|
|
|
#: ulng.rsopthotkeysdeletetrashcanoverrides
|
|
msgctxt "ulng.rsopthotkeysdeletetrashcanoverrides"
|
|
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
|
|
msgstr "Atalho %s para cm_Delete tem um parâmetro que se sobrepõe a esta definição. Quer alterar o parâmetro para usar a definição global?"
|
|
|
|
#: ulng.rsopthotkeysdeletetrashcanparameterexists
|
|
msgctxt "ulng.rsopthotkeysdeletetrashcanparameterexists"
|
|
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
|
|
msgstr "Atalho %s para cm_Delete tem de ter um parâmetro alterado para corresponder ao atalho %s. Quer alterá-lo?"
|
|
|
|
#: ulng.rsopthotkeysdescription
|
|
msgctxt "ulng.rsopthotkeysdescription"
|
|
msgid "Description"
|
|
msgstr "Descrição"
|
|
|
|
#: ulng.rsopthotkeysedithotkey
|
|
msgid "Edit hotkey for %s"
|
|
msgstr "Editar atalho para %s"
|
|
|
|
#: ulng.rsopthotkeysfixparameter
|
|
msgid "Fix parameter"
|
|
msgstr "Fixar parâmetro"
|
|
|
|
#: ulng.rsopthotkeyshotkey
|
|
msgctxt "ulng.rsopthotkeyshotkey"
|
|
msgid "Hotkey"
|
|
msgstr "Atalho"
|
|
|
|
#: ulng.rsopthotkeyshotkeys
|
|
msgctxt "ulng.rsopthotkeyshotkeys"
|
|
msgid "Hotkeys"
|
|
msgstr "Atalhos"
|
|
|
|
#: ulng.rsopthotkeysnohotkey
|
|
msgid "<none>"
|
|
msgstr "<nenhum>"
|
|
|
|
#: ulng.rsopthotkeysparameters
|
|
msgctxt "ulng.rsopthotkeysparameters"
|
|
msgid "Parameters"
|
|
msgstr "Parâmetros"
|
|
|
|
#: ulng.rsopthotkeyssetdeleteshortcut
|
|
msgid "Set shortcut to delete file"
|
|
msgstr "Definir atalho para Excluir arquivo"
|
|
|
|
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
|
|
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
|
|
msgstr "Para esta definição funcionar com o atalho %s, o atalho %s tem de ser atribuído a cm_Delete, mas já está atribuído a %s. Quer alterá-lo?"
|
|
|
|
#: ulng.rsopthotkeysshortcutfordeleteissequence
|
|
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
|
|
msgstr "Atalho %s para cm_Delete é uma sequência para a qual uma tecla de atalho com Shift revertido não pode ser atribuída. Esta definição pode não funcionar."
|
|
|
|
#: ulng.rsopthotkeysshortcutused
|
|
msgid "Shortcut in use"
|
|
msgstr "Atalho em uso"
|
|
|
|
#: ulng.rsopthotkeysshortcutusedtext1
|
|
msgid "Shortcut %s is already used."
|
|
msgstr "Atalho %s já está em uso."
|
|
|
|
#: ulng.rsopthotkeysshortcutusedtext2
|
|
msgid "Change it to %s?"
|
|
msgstr "Alterar para %s?"
|
|
|
|
#: ulng.rsopthotkeysusedby
|
|
msgid "used for %s in %s"
|
|
msgstr "usado para %s em %s"
|
|
|
|
#: ulng.rsopthotkeysusedwithdifferentparams
|
|
msgid "used for this command but with different parameters"
|
|
msgstr "usado por este comando mas com parâmetros diferentes"
|
|
|
|
#: ulng.rsoptionseditorarchivers
|
|
msgctxt "ulng.rsoptionseditorarchivers"
|
|
msgid "Archivers"
|
|
msgstr "Arquivadores"
|
|
|
|
#: ulng.rsoptionseditorautorefresh
|
|
msgctxt "ulng.rsoptionseditorautorefresh"
|
|
msgid "Auto refresh"
|
|
msgstr "Atualizar automaticamente"
|
|
|
|
#: ulng.rsoptionseditorbehavior
|
|
msgctxt "ulng.rsoptionseditorbehavior"
|
|
msgid "Behaviors"
|
|
msgstr "Comportamentos"
|
|
|
|
#: ulng.rsoptionseditorbriefview
|
|
msgctxt "ulng.rsoptionseditorbriefview"
|
|
msgid "Brief"
|
|
msgstr "Resumida"
|
|
|
|
#: ulng.rsoptionseditorcolors
|
|
msgctxt "ulng.rsoptionseditorcolors"
|
|
msgid "Colors"
|
|
msgstr "Cores"
|
|
|
|
#: ulng.rsoptionseditorcolumnsview
|
|
msgid "Columns"
|
|
msgstr "Colunas"
|
|
|
|
#: ulng.rsoptionseditorconfiguration
|
|
msgctxt "ulng.rsoptionseditorconfiguration"
|
|
msgid "Configuration"
|
|
msgstr "Configuração"
|
|
|
|
#: ulng.rsoptionseditorcustomcolumns
|
|
msgid "Custom columns"
|
|
msgstr "Personalizar colunas"
|
|
|
|
#: ulng.rsoptionseditordirectoryhotlist
|
|
msgctxt "ulng.rsoptionseditordirectoryhotlist"
|
|
msgid "Directory Hotlist"
|
|
msgstr "Lista de pastas"
|
|
|
|
#: ulng.rsoptionseditordraganddrop
|
|
msgid "Drag & drop"
|
|
msgstr "Arrastar & Largar"
|
|
|
|
#: ulng.rsoptionseditordriveslistbutton
|
|
msgid "Drives list button"
|
|
msgstr "Botão da lista de unidades"
|
|
|
|
#: ulng.rsoptionseditorfavoritetabs
|
|
msgid "Favorite Tabs"
|
|
msgstr "Guia Favoritos"
|
|
|
|
#: ulng.rsoptionseditorfileassicextra
|
|
msgid "File associations extra"
|
|
msgstr "Associação de arquivo extra"
|
|
|
|
#: ulng.rsoptionseditorfileassoc
|
|
msgctxt "ulng.rsoptionseditorfileassoc"
|
|
msgid "File associations"
|
|
msgstr "Associações de arquivos"
|
|
|
|
#: ulng.rsoptionseditorfilenewfiletypes
|
|
#, fuzzy
|
|
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
|
|
msgid "New"
|
|
msgstr "Novo"
|
|
|
|
#: ulng.rsoptionseditorfileoperations
|
|
msgctxt "ulng.rsoptionseditorfileoperations"
|
|
msgid "File operations"
|
|
msgstr "Operações de arquivos"
|
|
|
|
#: ulng.rsoptionseditorfilepanels
|
|
msgctxt "ulng.rsoptionseditorfilepanels"
|
|
msgid "File panels"
|
|
msgstr "Painéis de arquivos."
|
|
|
|
#: ulng.rsoptionseditorfilesearch
|
|
#, fuzzy
|
|
msgctxt "ulng.rsoptionseditorfilesearch"
|
|
msgid "File search"
|
|
msgstr "Localizar arquivo"
|
|
|
|
#: ulng.rsoptionseditorfilesviews
|
|
msgid "Files views"
|
|
msgstr "Visões de arquivos."
|
|
|
|
#: ulng.rsoptionseditorfiletypes
|
|
msgctxt "ulng.rsoptionseditorfiletypes"
|
|
msgid "File types"
|
|
msgstr "Tipos de arquivos."
|
|
|
|
#: ulng.rsoptionseditorfoldertabs
|
|
msgctxt "ulng.rsoptionseditorfoldertabs"
|
|
msgid "Folder tabs"
|
|
msgstr "Guia de pastas."
|
|
|
|
#: ulng.rsoptionseditorfoldertabsextra
|
|
msgid "Folder tabs extra"
|
|
msgstr "Guia extra de pasta."
|
|
|
|
#: ulng.rsoptionseditorfonts
|
|
msgctxt "ulng.rsoptionseditorfonts"
|
|
msgid "Fonts"
|
|
msgstr "Tipos de letra."
|
|
|
|
#: ulng.rsoptionseditorhighlighters
|
|
msgid "Highlighters"
|
|
msgstr "Realces"
|
|
|
|
#: ulng.rsoptionseditorhotkeys
|
|
msgctxt "ulng.rsoptionseditorhotkeys"
|
|
msgid "Hot keys"
|
|
msgstr "Atalhos"
|
|
|
|
#: ulng.rsoptionseditoricons
|
|
msgctxt "ulng.rsoptionseditoricons"
|
|
msgid "Icons"
|
|
msgstr "Ícones"
|
|
|
|
#: ulng.rsoptionseditorignorelist
|
|
msgctxt "ulng.rsoptionseditorignorelist"
|
|
msgid "Ignore list"
|
|
msgstr "Ignorar lista"
|
|
|
|
#: ulng.rsoptionseditorkeyboard
|
|
msgid "Keys"
|
|
msgstr "Teclas"
|
|
|
|
#: ulng.rsoptionseditorlanguage
|
|
msgctxt "ulng.rsoptionseditorlanguage"
|
|
msgid "Language"
|
|
msgstr "Idioma"
|
|
|
|
#: ulng.rsoptionseditorlayout
|
|
msgctxt "ulng.rsoptionseditorlayout"
|
|
msgid "Layout"
|
|
msgstr "Disposição"
|
|
|
|
#: ulng.rsoptionseditorlog
|
|
msgctxt "ulng.rsoptionseditorlog"
|
|
msgid "Log"
|
|
msgstr "Log"
|
|
|
|
#: ulng.rsoptionseditormiscellaneous
|
|
msgctxt "ulng.rsoptionseditormiscellaneous"
|
|
msgid "Miscellaneous"
|
|
msgstr "Vários"
|
|
|
|
#: ulng.rsoptionseditormouse
|
|
msgid "Mouse"
|
|
msgstr "Mouse"
|
|
|
|
#: ulng.rsoptionseditoroptionschanged
|
|
msgid ""
|
|
"Options have changed in \"%s\"\n"
|
|
"\n"
|
|
"Do you want to save modifications?\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptionseditorplugins
|
|
msgctxt "ulng.rsoptionseditorplugins"
|
|
msgid "Plugins"
|
|
msgstr "Suplementos"
|
|
|
|
#: ulng.rsoptionseditorquicksearch
|
|
msgctxt "ulng.rsoptionseditorquicksearch"
|
|
msgid "Quick search/filter"
|
|
msgstr "Procura/Filtragem rápida"
|
|
|
|
#: ulng.rsoptionseditorterminal
|
|
msgctxt "ulng.rsoptionseditorterminal"
|
|
msgid "Terminal"
|
|
msgstr "Terminal"
|
|
|
|
#: ulng.rsoptionseditortoolbar
|
|
msgid "Toolbar"
|
|
msgstr "Barra de ferramentas"
|
|
|
|
#: ulng.rsoptionseditortools
|
|
msgctxt "ulng.rsoptionseditortools"
|
|
msgid "Tools"
|
|
msgstr "Ferramentas"
|
|
|
|
#: ulng.rsoptionseditortooltips
|
|
msgctxt "ulng.rsoptionseditortooltips"
|
|
msgid "Tooltips"
|
|
msgstr "Sugestões"
|
|
|
|
#: ulng.rsoptionseditortreeviewmenu
|
|
msgctxt "ulng.rsoptionseditortreeviewmenu"
|
|
msgid "Tree View Menu"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptionseditortreeviewmenucolors
|
|
msgid "Tree View Menu Colors"
|
|
msgstr ""
|
|
|
|
#: ulng.rsoptletters
|
|
msgid "None;Command Line;Quick Search;Quick Filter"
|
|
msgstr "Nenhuma;Linha de comandos;Procura rápida;Filtragem rápida"
|
|
|
|
#: ulng.rsoptmouseselectionbutton
|
|
msgid "Left button;Right button;"
|
|
msgstr "Botão esquerdo;Botão direito;"
|
|
|
|
#: ulng.rsoptnewfilesposition
|
|
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
|
|
msgstr "no cimo da lista de arquivos;após as pastas (se as pastas estão ordenadas antes dos arquivos);na posiçõ ordenada;no final da lista de arquivos"
|
|
|
|
#: ulng.rsoptpluginalreadyassigned
|
|
msgid "Plugin %s is already assigned for the following extensions:"
|
|
msgstr "O suplemento %s já está atribuído às seguintes extensões:"
|
|
|
|
#: ulng.rsoptpluginsactive
|
|
msgctxt "ulng.rsoptpluginsactive"
|
|
msgid "Active"
|
|
msgstr "Ativo"
|
|
|
|
#: ulng.rsoptpluginsfilename
|
|
msgctxt "ulng.rsoptpluginsfilename"
|
|
msgid "File name"
|
|
msgstr "Nome de arquivo"
|
|
|
|
#: ulng.rsoptpluginsname
|
|
msgctxt "ulng.rsoptpluginsname"
|
|
msgid "Name"
|
|
msgstr "Nome"
|
|
|
|
#: ulng.rsoptpluginsregisteredfor
|
|
msgctxt "ulng.rsoptpluginsregisteredfor"
|
|
msgid "Registered for"
|
|
msgstr "Registado para"
|
|
|
|
#: ulng.rsoptsearchcase
|
|
msgid "&Sensitive;&Insensitive"
|
|
msgstr "&Sensível;&Insensível"
|
|
|
|
#: ulng.rsoptsearchitems
|
|
msgid "&Files;Di&rectories;Files a&nd Directories"
|
|
msgstr "&Arquivos;Pa&stas;arquivos e &pastas"
|
|
|
|
#: ulng.rsoptsearchopt
|
|
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
|
|
msgstr "Ocultar painel de filtra&gem quando não estiver em foco.;Manter salvo modificações dos parâmetros da da próxima seção."
|
|
|
|
#: ulng.rsoptsortcasesens
|
|
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
|
|
msgstr "não sensível a maiúsculas;de acordo com definições regionais (aAbBcC);primeiro maiśculas, depois minúsculas (ABCabc)."
|
|
|
|
#: ulng.rsoptsortfoldermode
|
|
msgid "sort by name and show first;sort like files and show first;sort like files"
|
|
msgstr "ordenar por nome e mostrar primeiro;ordenar como arquivos e mostrar primeiro;ordenar como arquivos"
|
|
|
|
#: ulng.rsoptsortmethod
|
|
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
|
|
msgstr "Alfabétca, considerando acentos;Ordem natural;alfabética e números"
|
|
|
|
#: ulng.rsopttabsposition
|
|
msgid "Top;Bottom;"
|
|
msgstr "Topo;Inferior;"
|
|
|
|
#: ulng.rsopttoolbarbuttontype
|
|
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
|
|
msgstr "S&eparador;Comando inte&rno;Comando e&xterno;Men&u"
|
|
|
|
#: ulng.rsopttypeofduplicatedrename
|
|
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
|
|
msgstr "DC legacy - Copiar (x) nome_de_arquivo.ext; Windows - nome_de_arquivo (x).ext; Outro - nome_do_arquivo (x).ext"
|
|
|
|
#: ulng.rsoptupdatedfilesposition
|
|
msgid "don't change position;use the same setting as for new files;to sorted position"
|
|
msgstr "não alterar posição;usar a definição para novos arquivos;para a posição ordenada"
|
|
|
|
#: ulng.rspropscontains
|
|
msgid "Files: %d, folders: %d"
|
|
msgstr "Arquivos: %d, pastas: %d"
|
|
|
|
#: ulng.rspropserrchmod
|
|
msgid "Can not change access rights for \"%s\""
|
|
msgstr "Impossível alterar direitos de acesso a \"%s\""
|
|
|
|
#: ulng.rspropserrchown
|
|
msgid "Can not change owner for \"%s\""
|
|
msgstr "Impossível alterar proprietário de \"%s\""
|
|
|
|
#: ulng.rspropsfile
|
|
msgctxt "ulng.rspropsfile"
|
|
msgid "File"
|
|
msgstr "arquivo"
|
|
|
|
#: ulng.rspropsfolder
|
|
msgctxt "ulng.rspropsfolder"
|
|
msgid "Directory"
|
|
msgstr "Pasta"
|
|
|
|
#: ulng.rspropsnmdpipe
|
|
msgid "Named pipe"
|
|
msgstr "Linha nomeada"
|
|
|
|
#: ulng.rspropssocket
|
|
msgid "Socket"
|
|
msgstr "Tomada"
|
|
|
|
#: ulng.rspropsspblkdev
|
|
msgid "Special block device"
|
|
msgstr "Dispositivo de bloqueio especial"
|
|
|
|
#: ulng.rspropsspchrdev
|
|
msgid "Special character device"
|
|
msgstr "Dispositivo de carácter especial"
|
|
|
|
#: ulng.rspropssymlink
|
|
msgid "Symbolic link"
|
|
msgstr "Ligação simbólica"
|
|
|
|
#: ulng.rspropsunknowntype
|
|
msgid "Unknown type"
|
|
msgstr "Tipo desconhecido"
|
|
|
|
#: ulng.rssearchresult
|
|
msgid "Search result"
|
|
msgstr "Resultado da procura"
|
|
|
|
#: ulng.rssearchstatus
|
|
msgid "SEARCH"
|
|
msgstr "PESQUISAR"
|
|
|
|
#: ulng.rssearchtemplateunnamed
|
|
msgid "<unnamed template>"
|
|
msgstr "<modelo sem nome>"
|
|
|
|
#: ulng.rssearchwithdsxplugininprogress
|
|
msgid ""
|
|
"A file search using DSX plugin is already in progress.\n"
|
|
"We need that one to be completed before to launch a new one.\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rssearchwithwdxplugininprogress
|
|
msgid ""
|
|
"A file search using WDX plugin is already in progress.\n"
|
|
"We need that one to be completed before to launch a new one.\n"
|
|
msgstr ""
|
|
|
|
#: ulng.rsselectdir
|
|
msgid "Select a directory"
|
|
msgstr "Selecione uma pasta"
|
|
|
|
#: ulng.rsselectyoufindfileswindow
|
|
msgid "Select your window"
|
|
msgstr ""
|
|
|
|
#: ulng.rsshowhelpfor
|
|
msgid "&Show help for %s"
|
|
msgstr "Mo&strar ajuda para %s"
|
|
|
|
#: ulng.rssimplewordall
|
|
msgctxt "ulng.rssimplewordall"
|
|
msgid "All"
|
|
msgstr "Tudo"
|
|
|
|
#: ulng.rssimplewordcategory
|
|
msgctxt "ulng.rssimplewordcategory"
|
|
msgid "Category"
|
|
msgstr "Categoria"
|
|
|
|
#: ulng.rssimplewordcolumnsingular
|
|
msgid "Column"
|
|
msgstr "Coluna"
|
|
|
|
#: ulng.rssimplewordcommand
|
|
msgctxt "ulng.rssimplewordcommand"
|
|
msgid "Command"
|
|
msgstr "Commando"
|
|
|
|
#: ulng.rssimplewordfilename
|
|
msgid "Filename"
|
|
msgstr "NOme arquivo"
|
|
|
|
#: ulng.rssimplewordfiles
|
|
msgid "files"
|
|
msgstr "arquivos"
|
|
|
|
#: ulng.rssimplewordletter
|
|
msgid "Letter"
|
|
msgstr ""
|
|
|
|
#: ulng.rssimplewordparameter
|
|
msgid "Param"
|
|
msgstr "Param"
|
|
|
|
#: ulng.rssimplewordresult
|
|
msgid "Result"
|
|
msgstr "Resultado"
|
|
|
|
#: ulng.rssimplewordworkdir
|
|
msgid "WorkDir"
|
|
msgstr "Pasta de trabalho"
|
|
|
|
#: ulng.rssizeunitbytes
|
|
msgid "Bytes"
|
|
msgstr "Bytes"
|
|
|
|
#: ulng.rssizeunitgbytes
|
|
msgctxt "ulng.rssizeunitgbytes"
|
|
msgid "Gigabytes"
|
|
msgstr "Gigabytes"
|
|
|
|
#: ulng.rssizeunitkbytes
|
|
msgctxt "ulng.rssizeunitkbytes"
|
|
msgid "Kilobytes"
|
|
msgstr "Kilobytes"
|
|
|
|
#: ulng.rssizeunitmbytes
|
|
msgctxt "ulng.rssizeunitmbytes"
|
|
msgid "Megabytes"
|
|
msgstr "Megabytes"
|
|
|
|
#: ulng.rssizeunittbytes
|
|
msgid "Terabytes"
|
|
msgstr "Terabytes"
|
|
|
|
#: ulng.rsspacemsg
|
|
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
|
|
msgstr "Arquivos: %d, pastas: %d, tamanho: %s (%s bytes)"
|
|
|
|
#: ulng.rsspliterrdirectory
|
|
msgid "Unable to create target directory!"
|
|
msgstr "Impossível criar pasta destino!"
|
|
|
|
#: ulng.rsspliterrfilesize
|
|
msgid "Incorrect file size format!"
|
|
msgstr "Formato de tamanho de arquivo incorreto!"
|
|
|
|
#: ulng.rsspliterrsplitfile
|
|
msgid "Unable to split the file!"
|
|
msgstr "Impossível dividir o arquivo!"
|
|
|
|
#: ulng.rssplitmsgmanyparts
|
|
msgid "The number of parts is more than 100! Continue?"
|
|
msgstr "O número de partes é superior a 100! Continuar?"
|
|
|
|
#: ulng.rssplitpredefinedsizes
|
|
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
|
|
msgstr ""
|
|
|
|
#: ulng.rssplitseldir
|
|
msgid "Select directory:"
|
|
msgstr "Pasta selecionada:"
|
|
|
|
#: ulng.rsstraccents
|
|
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstraccentsstripped
|
|
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewjustpreview
|
|
msgid "Just preview"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewothers
|
|
msgid "Others"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewsearchingletters
|
|
msgid "OU"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewsidenote
|
|
msgid "Side note"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithoutsearched1
|
|
msgid "Flat"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithoutsearched2
|
|
msgid "Limited"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithoutsearched3
|
|
msgid "Simple"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithsearched1
|
|
msgid "Fabulous"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithsearched2
|
|
msgid "Marvelous"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrpreviewwordwithsearched3
|
|
msgid "Tremendous"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosedirhistory
|
|
msgid "Choose your directory from Dir History"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosefavoritetabs
|
|
msgid "Choose you Favorite Tabs:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosefromcmdlinehistory
|
|
msgid "Choose your command from Command Line History"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosefrommainmenu
|
|
msgid "Choose your action from Main Menu"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosefromtoolbar
|
|
msgid "Choose your action from Maintool bar"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchoosehotdirectory
|
|
msgid "Choose your directory from Hot Directory:"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchooseviewhistory
|
|
msgid "Choose your directory from File View History"
|
|
msgstr ""
|
|
|
|
#: ulng.rsstrtvmchooseyourfileordir
|
|
msgid "Choose your file or your directory"
|
|
msgstr ""
|
|
|
|
#: ulng.rssymerrcreate
|
|
msgid "Error creating symlink."
|
|
msgstr "Erro ao criar ligação simbólica"
|
|
|
|
#: ulng.rssyndefaulttext
|
|
msgctxt "ulng.rssyndefaulttext"
|
|
msgid "Default text"
|
|
msgstr "Texto predefinido"
|
|
|
|
#: ulng.rssynlangplaintext
|
|
msgctxt "ulng.rssynlangplaintext"
|
|
msgid "Plain text"
|
|
msgstr "Texto simples"
|
|
|
|
#: ulng.rstabsactionondoubleclickchoices
|
|
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
|
|
msgstr "Não faça nada: guia Fechar; guia Acesso Favorito; menu pop-up de Guias"
|
|
|
|
#: ulng.rstimeunitday
|
|
msgctxt "ulng.rstimeunitday"
|
|
msgid "Day(s)"
|
|
msgstr "Dia(s)"
|
|
|
|
#: ulng.rstimeunithour
|
|
msgid "Hour(s)"
|
|
msgstr "Hora(s)"
|
|
|
|
#: ulng.rstimeunitminute
|
|
msgid "Minute(s)"
|
|
msgstr "Minuto(s)"
|
|
|
|
#: ulng.rstimeunitmonth
|
|
msgid "Month(s)"
|
|
msgstr "Mês(Meses)"
|
|
|
|
#: ulng.rstimeunitsecond
|
|
msgid "Second(s)"
|
|
msgstr "Segundo(s)"
|
|
|
|
#: ulng.rstimeunitweek
|
|
msgid "Week(s)"
|
|
msgstr "Semana(s)"
|
|
|
|
#: ulng.rstimeunityear
|
|
msgid "Year(s)"
|
|
msgstr "Ano(s)"
|
|
|
|
#: ulng.rstitlerenamefavtabs
|
|
msgid "Rename Favorite Tabs"
|
|
msgstr "Renomear Guia Favoritos"
|
|
|
|
#: ulng.rstitlerenamefavtabsmenu
|
|
msgid "Rename Favorite Tabs sub-menu"
|
|
msgstr "Renomear sub-menu da guia Favoritos"
|
|
|
|
#: ulng.rstooldiffer
|
|
msgctxt "ulng.rstooldiffer"
|
|
msgid "Differ"
|
|
msgstr "Diferenciar"
|
|
|
|
#: ulng.rstooleditor
|
|
msgctxt "ulng.rstooleditor"
|
|
msgid "Editor"
|
|
msgstr "Editor"
|
|
|
|
#: ulng.rstoolerroropeningdiffer
|
|
msgid "Error opening differ"
|
|
msgstr "Erro ao abrir Diferenciar"
|
|
|
|
#: ulng.rstoolerroropeningeditor
|
|
msgid "Error opening editor"
|
|
msgstr "Erro ao abrir o editor"
|
|
|
|
#: ulng.rstoolerroropeningterminal
|
|
msgid "Error opening terminal"
|
|
msgstr "Erro ao abrir o terminal"
|
|
|
|
#: ulng.rstoolerroropeningviewer
|
|
msgid "Error opening viewer"
|
|
msgstr "Erro ao abrir o visualizador"
|
|
|
|
#: ulng.rstoolterminal
|
|
msgctxt "ulng.rstoolterminal"
|
|
msgid "Terminal"
|
|
msgstr "Terminal"
|
|
|
|
#: ulng.rstoolviewer
|
|
msgctxt "ulng.rstoolviewer"
|
|
msgid "Viewer"
|
|
msgstr "Visualizador"
|
|
|
|
#: ulng.rsunhandledexceptionmessage
|
|
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
|
|
msgstr "Por favor reporte este erro no rastreio de erros com uma descrição do que estava a fazer e o arquivo seguinte: %sPrima %s para continuar ou %s para abortar o programa."
|
|
|
|
#: ulng.rsvarbothpanelactivetoinactive
|
|
msgid "Both panels, from active to inactive"
|
|
msgstr "Ambos paineis. Do ativo para o inativo"
|
|
|
|
#: ulng.rsvarbothpanellefttoright
|
|
msgid "Both panels, from left to right"
|
|
msgstr "Ambos paineis, da esquerda para direita"
|
|
|
|
#: ulng.rsvarcurrentpath
|
|
msgid "Path of panel"
|
|
msgstr "Caminho do painel"
|
|
|
|
#: ulng.rsvarencloseelement
|
|
msgid "Enclose each name in brackets or what you want"
|
|
msgstr "Coloque cada nome entre parênteses ou o que você quiser"
|
|
|
|
#: ulng.rsvarfilenamenoext
|
|
msgid "Just filename, no extension"
|
|
msgstr "Somente nome arquivo. Sem extensão"
|
|
|
|
#: ulng.rsvarfullpath
|
|
msgid "Complete filename (path+filename)"
|
|
msgstr "Nome arquivo completo (caminho+nome)"
|
|
|
|
#: ulng.rsvarhelpwith
|
|
msgid "Help with \"%\" variables"
|
|
msgstr "Ajuda com \"%\" variáveis"
|
|
|
|
#: ulng.rsvarinputparam
|
|
msgid "Will request request user to enter a parameter with a default suggested value"
|
|
msgstr "Solicitará ao usuário que insira um parâmetro com um valor sugerido padrão"
|
|
|
|
#: ulng.rsvarleftpanel
|
|
msgid "Left panel"
|
|
msgstr "Painel esquerdo"
|
|
|
|
#: ulng.rsvarlistfilename
|
|
msgid "Temporary filename of list of filenames"
|
|
msgstr "Nome de arquivo temporário da lista de nomes de arquivos"
|
|
|
|
#: ulng.rsvarlistfullfilename
|
|
msgid "Temporary filename of list of complete filenames (path+filename)"
|
|
msgstr "Nome de arquivo temporário da lista de nomes de arquivos com caminho relativo"
|
|
|
|
#: ulng.rsvarlistinutf16
|
|
msgid "Filenames in list in UTF-16 with BOM"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarlistinutf16quoted
|
|
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarlistinutf8
|
|
msgid "Filenames in list in UTF-8"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarlistinutf8quoted
|
|
msgid "Filenames in list in UTF-8, inside double quotes"
|
|
msgstr ""
|
|
|
|
#: ulng.rsvarlistrelativefilename
|
|
msgid "Temporary filename of list of filenames with relative path"
|
|
msgstr "Nome de arquivo temporário da lista de nomes de arquivos com caminhos relativos"
|
|
|
|
#: ulng.rsvaronlyextension
|
|
msgid "Only file extension"
|
|
msgstr "Somente extensão de arquivo"
|
|
|
|
#: ulng.rsvaronlyfilename
|
|
msgid "Only filename"
|
|
msgstr "Somente nome de arquivo"
|
|
|
|
#: ulng.rsvarotherexamples
|
|
msgid "Other example of what's possible"
|
|
msgstr "Outro exemplo do que é possível"
|
|
|
|
#: ulng.rsvarpath
|
|
#, fuzzy
|
|
#| msgid "Path, with ending delimiter"
|
|
msgid "Path, without ending delimiter"
|
|
msgstr "Caminho com delimitador no final"
|
|
|
|
#: ulng.rsvarpercentchangetopound
|
|
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
|
|
msgstr "Daqui até o final da linha, o indicador de porcentagem é o sinal \"# \""
|
|
|
|
#: ulng.rsvarpercentsign
|
|
msgid "Return the percent sign"
|
|
msgstr "Retornar o sinal de porcentagem."
|
|
|
|
#: ulng.rsvarpoundchangetopercent
|
|
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
|
|
msgstr "Daqui até o final da linha, o indicador de porcentagem está de volta com o sinal \"%\""
|
|
|
|
#: ulng.rsvarprependelement
|
|
msgid "Prepend each name with \"-a \" or what you want"
|
|
msgstr "Preencha cada nome com \"- a \" ou o que você quiser"
|
|
|
|
#: ulng.rsvarpromptuserforparam
|
|
msgid "%[Prompt user for param;Default value proposed]"
|
|
msgstr "%[Prompt de usuário para param; Valor padrão proposto]"
|
|
|
|
#: ulng.rsvarrelativepathandfilename
|
|
msgid "Filename with relative path"
|
|
msgstr "Nome de arquivo com caminho relativo"
|
|
|
|
#: ulng.rsvarrightpanel
|
|
msgid "Right panel"
|
|
msgstr "Painel direito"
|
|
|
|
#: ulng.rsvarsecondelementrightpanel
|
|
msgid "Full path of second selected file in right panel"
|
|
msgstr "Caminho completo do segundo arquivo selecionado no painel direito"
|
|
|
|
#: ulng.rsvarshowcommandprior
|
|
msgid "Show command prior execute"
|
|
msgstr "Mostrar comando antes de executar"
|
|
|
|
#: ulng.rsvarsimplemessage
|
|
msgid "%[Simple message]"
|
|
msgstr "%[Simples mensagem]"
|
|
|
|
#: ulng.rsvarsimpleshowmessage
|
|
msgid "Will show a simple message"
|
|
msgstr "Será mostrada uma simples mensagem"
|
|
|
|
#: ulng.rsvarsourcepanel
|
|
msgid "Active panel (source)"
|
|
msgstr "Painel ativo (fonte)"
|
|
|
|
#: ulng.rsvartargetpanel
|
|
msgid "Inactive panel (target)"
|
|
msgstr "Painel inativo (destino)"
|
|
|
|
#: ulng.rsvarwillbequoted
|
|
msgid "Filenames will be quoted from here (default)"
|
|
msgstr "Os nomes de arquivo serão citados a partir daqui (padrão)"
|
|
|
|
#: ulng.rsvarwilldointerminal
|
|
msgid "Command will be done in terminal, remaining opened at the end"
|
|
msgstr "O comando será executado no terminal e permanecendo aberto no final"
|
|
|
|
#: ulng.rsvarwillhaveendingdelimiter
|
|
msgid "Paths will have ending delimiter"
|
|
msgstr "Caminhos terão delimitador final"
|
|
|
|
#: ulng.rsvarwillnotbequoted
|
|
msgid "Filenames will not be quoted from here"
|
|
msgstr "Os nomes de arquivo não serão citados aqui"
|
|
|
|
#: ulng.rsvarwillnotdointerminal
|
|
msgid "Command will be done in terminal, closed at the end"
|
|
msgstr "O comando será executado no terminal e fechado no final"
|
|
|
|
#: ulng.rsvarwillnothaveendingdelimiter
|
|
msgid "Paths will not have ending delimiter (default)"
|
|
msgstr "Caminhos não terão delimitador final (padrão)"
|
|
|
|
#: ulng.rsvfsnetwork
|
|
msgctxt "ulng.rsvfsnetwork"
|
|
msgid "Network"
|
|
msgstr "Rede"
|
|
|
|
#: ulng.rsviewabouttext
|
|
msgid "Internal Viewer of Double Commander."
|
|
msgstr "Visualizador interno do Double Commander."
|
|
|
|
#: ulng.rsviewbadquality
|
|
msgid "Bad Quality"
|
|
msgstr "Qualidade Ruim"
|
|
|
|
#: ulng.rsviewencoding
|
|
msgctxt "ulng.rsviewencoding"
|
|
msgid "Encoding"
|
|
msgstr "A codificar"
|
|
|
|
#: ulng.rsviewimagetype
|
|
msgid "Image Type"
|
|
msgstr "Tipo de Imagem"
|
|
|
|
#: ulng.rsviewnewsize
|
|
msgctxt "ulng.rsviewnewsize"
|
|
msgid "New Size"
|
|
msgstr "Novo tamanho"
|
|
|
|
#: ulng.rsviewnotfound
|
|
msgid "%s not found!"
|
|
msgstr "%s não encontrado!"
|
|
|
|
#: ulng.rsviewwithexternalviewer
|
|
msgid "with external viewer"
|
|
msgstr "com visualizador externo."
|
|
|
|
#: ulng.rsviewwithinternalviewer
|
|
msgid "with internal viewer"
|
|
msgstr "com visualizador interno."
|
|
|
|
#: ulng.rsxreplacements
|
|
msgid "Number of replacement: %d"
|
|
msgstr "Número de substituições: %d"
|
|
|
|
#: ulng.rszeroreplacement
|
|
msgid "No replacement took place."
|
|
msgstr "Não houve substituição."
|
|
|