doublecmd/language/doublecmd.po
2017-03-11 10:42:48 +00:00

11910 lines
268 KiB
Text

msgid ""
msgstr ""
"Project-Id-Version: Double Commander 0.8.0 alpha\n"
"Report-Msgid-Bugs-To: \n"
"POT-Creation-Date: 2008-01-17 23:08+0300\n"
"PO-Revision-Date: YEAR-MO-DA HO:MI+ZONE\n"
"Last-Translator: Full Name <email@address>\n"
"Language-Team: Language <email@address>\n"
"MIME-Version: 1.0\n"
"Content-Type: text/plain; charset=utf-8\n"
"Content-Transfer-Encoding: 8bit\n"
"X-Native-Language: English\n"
#: fsyncdirsdlg.rscomparingpercent
msgid "Comparing... %d%% (ESC to cancel)"
msgstr ""
#: fsyncdirsdlg.rsdeleteright
msgid "Right: Delete %d file(s)"
msgstr ""
#: fsyncdirsdlg.rsfilesfound
msgid "Files found: %d (Identical: %d, Different: %d, Unique left: %d, Unique right: %d)"
msgstr ""
#: fsyncdirsdlg.rslefttorightcopy
msgid "Left to Right: Copy %d files, total size: %d bytes"
msgstr ""
#: fsyncdirsdlg.rsrighttoleftcopy
msgid "Right to Left: Copy %d files, total size: %d bytes"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.btnsearchtemplate.hint
msgid "Choose template..."
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbcheckfreespace.caption
msgid "C&heck free space"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbcopyattributes.caption
msgid "Cop&y attributes"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbcopyownership.caption
msgid "Copy o&wnership"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbcopypermissions.caption
msgid "Copy &permissions"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbcopytime.caption
msgctxt "tfilesystemcopymoveoperationoptionsui.cbcopytime.caption"
msgid "Copy d&ate/time"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbcorrectlinks.caption
msgid "Correct lin&ks"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbdropreadonlyflag.caption
msgid "Drop readonly fla&g"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbexcludeemptydirectories.caption
msgid "E&xclude empty directories"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbfollowlinks.caption
msgid "Fo&llow links"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cbreservespace.caption
msgid "&Reserve space"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.chkverify.caption
msgid "&Verify"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.cmbsetpropertyerror.hint
msgid "What to do when cannot set file time, attributes, etc."
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.gbfiletemplate.caption
msgid "Use file template"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.lbldirectoryexists.caption
msgid "When dir&ectory exists"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.lblfileexists.caption
msgid "When &file exists"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.lblsetpropertyerror.caption
msgid "When ca&nnot set property"
msgstr ""
#: tfilesystemcopymoveoperationoptionsui.lbltemplatename.caption
msgid "<no template>"
msgstr ""
#: tfrmabout.btnclose.caption
msgctxt "tfrmabout.btnclose.caption"
msgid "&Close"
msgstr ""
#: tfrmabout.btncopytoclipboard.caption
msgid "Copy to clipboard"
msgstr ""
#: tfrmabout.caption
msgctxt "tfrmabout.caption"
msgid "About"
msgstr ""
#: tfrmabout.lblbuild.caption
msgctxt "tfrmabout.lblbuild.caption"
msgid "Build"
msgstr ""
#: tfrmabout.lblfreepascalver.caption
msgctxt "tfrmabout.lblfreepascalver.caption"
msgid "Free Pascal"
msgstr ""
#: tfrmabout.lblhomepage.caption
msgid "Home Page:"
msgstr ""
#: tfrmabout.lblhomepageaddress.caption
msgid "http://doublecmd.sourceforge.net"
msgstr ""
#: tfrmabout.lbllazarusver.caption
msgctxt "tfrmabout.lbllazarusver.caption"
msgid "Lazarus"
msgstr ""
#: tfrmabout.lblrevision.caption
msgctxt "tfrmabout.lblrevision.caption"
msgid "Revision"
msgstr ""
#: tfrmabout.lbltitle.caption
msgctxt "tfrmabout.lbltitle.caption"
msgid "Double Commander"
msgstr ""
#: tfrmabout.lblversion.caption
msgctxt "tfrmabout.lblversion.caption"
msgid "Version"
msgstr ""
#: tfrmattributesedit.btncancel.caption
msgctxt "tfrmattributesedit.btncancel.caption"
msgid "&Cancel"
msgstr ""
#: tfrmattributesedit.btnok.caption
msgctxt "tfrmattributesedit.btnok.caption"
msgid "&OK"
msgstr ""
#: tfrmattributesedit.btnreset.caption
msgid "&Reset"
msgstr ""
#: tfrmattributesedit.caption
msgid "Choose attributes"
msgstr ""
#: tfrmattributesedit.cbarchive.caption
msgid "&Archive"
msgstr ""
#: tfrmattributesedit.cbcompressed.caption
msgid "Co&mpressed"
msgstr ""
#: tfrmattributesedit.cbdirectory.caption
msgid "&Directory"
msgstr ""
#: tfrmattributesedit.cbencrypted.caption
msgid "&Encrypted"
msgstr ""
#: tfrmattributesedit.cbhidden.caption
msgid "&Hidden"
msgstr ""
#: tfrmattributesedit.cbreadonly.caption
msgid "Read o&nly"
msgstr ""
#: tfrmattributesedit.cbsgid.caption
msgctxt "tfrmattributesedit.cbsgid.caption"
msgid "SGID"
msgstr ""
#: tfrmattributesedit.cbsparse.caption
msgid "S&parse"
msgstr ""
#: tfrmattributesedit.cbsticky.caption
msgctxt "tfrmattributesedit.cbsticky.caption"
msgid "Sticky"
msgstr ""
#: tfrmattributesedit.cbsuid.caption
msgctxt "tfrmattributesedit.cbsuid.caption"
msgid "SUID"
msgstr ""
#: tfrmattributesedit.cbsymlink.caption
msgid "&Symlink"
msgstr ""
#: tfrmattributesedit.cbsystem.caption
msgid "S&ystem"
msgstr ""
#: tfrmattributesedit.cbtemporary.caption
msgid "&Temporary"
msgstr ""
#: tfrmattributesedit.gbntfsattributes.caption
msgid "NTFS attributes"
msgstr ""
#: tfrmattributesedit.gbwingeneral.caption
msgid "General attributes"
msgstr ""
#: tfrmattributesedit.lblattrbitsstr.caption
msgctxt "tfrmattributesedit.lblattrbitsstr.caption"
msgid "Bits:"
msgstr ""
#: tfrmattributesedit.lblattrgroupstr.caption
msgctxt "tfrmattributesedit.lblattrgroupstr.caption"
msgid "Group"
msgstr ""
#: tfrmattributesedit.lblattrotherstr.caption
msgctxt "tfrmattributesedit.lblattrotherstr.caption"
msgid "Other"
msgstr ""
#: tfrmattributesedit.lblattrownerstr.caption
msgctxt "tfrmattributesedit.lblattrownerstr.caption"
msgid "Owner"
msgstr ""
#: tfrmattributesedit.lblexec.caption
msgctxt "tfrmattributesedit.lblexec.caption"
msgid "Execute"
msgstr ""
#: tfrmattributesedit.lblread.caption
msgctxt "tfrmattributesedit.lblread.caption"
msgid "Read"
msgstr ""
#: tfrmattributesedit.lbltextattrs.caption
msgid "As te&xt:"
msgstr ""
#: tfrmattributesedit.lblwrite.caption
msgctxt "tfrmattributesedit.lblwrite.caption"
msgid "Write"
msgstr ""
#: tfrmchecksumcalc.caption
msgctxt "tfrmchecksumcalc.caption"
msgid "Calculate checksum..."
msgstr ""
#: tfrmchecksumcalc.cbopenafterjobiscomplete.caption
msgid "Open checksum file after job is completed"
msgstr ""
#: tfrmchecksumcalc.cbseparatefile.caption
msgid "C&reate separate checksum file for each file"
msgstr ""
#: tfrmchecksumcalc.lblsaveto.caption
msgid "&Save checksum file(s) to:"
msgstr ""
#: tfrmchecksumverify.btnclose.caption
msgctxt "TFRMCHECKSUMVERIFY.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr ""
#: tfrmchecksumverify.caption
msgctxt "tfrmchecksumverify.caption"
msgid "Verify checksum..."
msgstr ""
#: tfrmconnectionmanager.btnadd.caption
msgctxt "tfrmconnectionmanager.btnadd.caption"
msgid "A&dd"
msgstr ""
#: tfrmconnectionmanager.btncancel.caption
msgctxt "TFRMCONNECTIONMANAGER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmconnectionmanager.btnconnect.caption
msgid "C&onnect"
msgstr ""
#: tfrmconnectionmanager.btndelete.caption
msgctxt "tfrmconnectionmanager.btndelete.caption"
msgid "&Delete"
msgstr ""
#: tfrmconnectionmanager.btnedit.caption
msgctxt "tfrmconnectionmanager.btnedit.caption"
msgid "&Edit"
msgstr ""
#: tfrmconnectionmanager.caption
msgid "Connection manager"
msgstr ""
#: tfrmconnectionmanager.gbconnectto.caption
msgid "Connect to:"
msgstr ""
#: tfrmcopydlg.btnaddtoqueue.caption
msgid "A&dd To Queue"
msgstr ""
#: tfrmcopydlg.btncancel.caption
msgctxt "TFRMCOPYDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmcopydlg.btnoptions.caption
msgid "O&ptions"
msgstr ""
#: tfrmcopydlg.btnsaveoptions.caption
msgid "Sa&ve these options as default"
msgstr ""
#: tfrmcopydlg.caption
msgctxt "tfrmcopydlg.caption"
msgid "Copy file(s)"
msgstr ""
#: tfrmcopydlg.mnunewqueue.caption
msgid "New queue"
msgstr ""
#: tfrmcopydlg.mnuqueue1.caption
msgid "Queue 1"
msgstr ""
#: tfrmcopydlg.mnuqueue2.caption
msgid "Queue 2"
msgstr ""
#: tfrmcopydlg.mnuqueue3.caption
msgid "Queue 3"
msgstr ""
#: tfrmcopydlg.mnuqueue4.caption
msgid "Queue 4"
msgstr ""
#: tfrmcopydlg.mnuqueue5.caption
msgid "Queue 5"
msgstr ""
#: tfrmdescredit.actsavedescription.caption
msgid "Save Description"
msgstr ""
#: tfrmdescredit.btncancel.caption
msgctxt "TFRMDESCREDIT.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmdescredit.btnok.caption
msgctxt "TFRMDESCREDIT.BTNOK.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmdescredit.caption
msgid "File/folder comment"
msgstr ""
#: tfrmdescredit.lbleditcommentfor.caption
msgid "E&dit comment for:"
msgstr ""
#: tfrmdescredit.lblencoding.caption
msgid "&Encoding:"
msgstr ""
#: tfrmdescredit.lblfilename.caption
msgctxt "tfrmdescredit.lblfilename.caption"
msgid "???"
msgstr ""
#: tfrmdiffer.actabout.caption
msgctxt "TFRMDIFFER.ACTABOUT.CAPTION"
msgid "About"
msgstr ""
#: tfrmdiffer.actautocompare.caption
msgid "Auto Compare"
msgstr ""
#: tfrmdiffer.actbinarycompare.caption
msgid "Binary Mode"
msgstr ""
#: tfrmdiffer.actcancelcompare.caption
msgctxt "tfrmdiffer.actcancelcompare.caption"
msgid "Cancel"
msgstr ""
#: tfrmdiffer.actcancelcompare.hint
msgctxt "TFRMDIFFER.ACTCANCELCOMPARE.HINT"
msgid "Cancel"
msgstr ""
#: tfrmdiffer.actcopylefttoright.caption
msgctxt "tfrmdiffer.actcopylefttoright.caption"
msgid "Copy Block Right"
msgstr ""
#: tfrmdiffer.actcopylefttoright.hint
msgctxt "TFRMDIFFER.ACTCOPYLEFTTORIGHT.HINT"
msgid "Copy Block Right"
msgstr ""
#: tfrmdiffer.actcopyrighttoleft.caption
msgctxt "tfrmdiffer.actcopyrighttoleft.caption"
msgid "Copy Block Left"
msgstr ""
#: tfrmdiffer.actcopyrighttoleft.hint
msgctxt "TFRMDIFFER.ACTCOPYRIGHTTOLEFT.HINT"
msgid "Copy Block Left"
msgstr ""
#: tfrmdiffer.acteditcopy.caption
msgctxt "tfrmdiffer.acteditcopy.caption"
msgid "Copy"
msgstr ""
#: tfrmdiffer.acteditcut.caption
msgctxt "tfrmdiffer.acteditcut.caption"
msgid "Cut"
msgstr ""
#: tfrmdiffer.acteditdelete.caption
msgctxt "tfrmdiffer.acteditdelete.caption"
msgid "Delete"
msgstr ""
#: tfrmdiffer.acteditpaste.caption
msgctxt "tfrmdiffer.acteditpaste.caption"
msgid "Paste"
msgstr ""
#: tfrmdiffer.acteditredo.caption
msgctxt "tfrmdiffer.acteditredo.caption"
msgid "Redo"
msgstr ""
#: tfrmdiffer.acteditselectall.caption
msgid "Select &All"
msgstr ""
#: tfrmdiffer.acteditundo.caption
msgctxt "tfrmdiffer.acteditundo.caption"
msgid "Undo"
msgstr ""
#: tfrmdiffer.actexit.caption
msgctxt "tfrmdiffer.actexit.caption"
msgid "E&xit"
msgstr ""
#: tfrmdiffer.actfirstdifference.caption
msgctxt "tfrmdiffer.actfirstdifference.caption"
msgid "First Difference"
msgstr ""
#: tfrmdiffer.actfirstdifference.hint
msgctxt "TFRMDIFFER.ACTFIRSTDIFFERENCE.HINT"
msgid "First Difference"
msgstr ""
#: tfrmdiffer.actignorecase.caption
msgid "Ignore Case"
msgstr ""
#: tfrmdiffer.actignorewhitespace.caption
msgid "Ignore Blanks"
msgstr ""
#: tfrmdiffer.actkeepscrolling.caption
msgid "Keep Scrolling"
msgstr ""
#: tfrmdiffer.actlastdifference.caption
msgctxt "tfrmdiffer.actlastdifference.caption"
msgid "Last Difference"
msgstr ""
#: tfrmdiffer.actlastdifference.hint
msgctxt "TFRMDIFFER.ACTLASTDIFFERENCE.HINT"
msgid "Last Difference"
msgstr ""
#: tfrmdiffer.actlinedifferences.caption
msgid "Line Differences"
msgstr ""
#: tfrmdiffer.actnextdifference.caption
msgctxt "tfrmdiffer.actnextdifference.caption"
msgid "Next Difference"
msgstr ""
#: tfrmdiffer.actnextdifference.hint
msgctxt "TFRMDIFFER.ACTNEXTDIFFERENCE.HINT"
msgid "Next Difference"
msgstr ""
#: tfrmdiffer.actopenleft.caption
msgid "Open Left..."
msgstr ""
#: tfrmdiffer.actopenright.caption
msgid "Open Right..."
msgstr ""
#: tfrmdiffer.actpaintbackground.caption
msgid "Paint Background"
msgstr ""
#: tfrmdiffer.actprevdifference.caption
msgctxt "tfrmdiffer.actprevdifference.caption"
msgid "Previous Difference"
msgstr ""
#: tfrmdiffer.actprevdifference.hint
msgctxt "TFRMDIFFER.ACTPREVDIFFERENCE.HINT"
msgid "Previous Difference"
msgstr ""
#: tfrmdiffer.actreload.caption
msgid "&Reload"
msgstr ""
#: tfrmdiffer.actreload.hint
msgctxt "tfrmdiffer.actreload.hint"
msgid "Reload"
msgstr ""
#: tfrmdiffer.actsave.caption
msgctxt "tfrmdiffer.actsave.caption"
msgid "Save"
msgstr ""
#: tfrmdiffer.actsave.hint
msgctxt "TFRMDIFFER.ACTSAVE.HINT"
msgid "Save"
msgstr ""
#: tfrmdiffer.actsaveas.caption
msgctxt "tfrmdiffer.actsaveas.caption"
msgid "Save as..."
msgstr ""
#: tfrmdiffer.actsaveas.hint
msgctxt "TFRMDIFFER.ACTSAVEAS.HINT"
msgid "Save as..."
msgstr ""
#: tfrmdiffer.actsaveleft.caption
msgctxt "tfrmdiffer.actsaveleft.caption"
msgid "Save Left"
msgstr ""
#: tfrmdiffer.actsaveleft.hint
msgctxt "TFRMDIFFER.ACTSAVELEFT.HINT"
msgid "Save Left"
msgstr ""
#: tfrmdiffer.actsaveleftas.caption
msgctxt "tfrmdiffer.actsaveleftas.caption"
msgid "Save Left As..."
msgstr ""
#: tfrmdiffer.actsaveleftas.hint
msgctxt "TFRMDIFFER.ACTSAVELEFTAS.HINT"
msgid "Save Left As..."
msgstr ""
#: tfrmdiffer.actsaveright.caption
msgctxt "tfrmdiffer.actsaveright.caption"
msgid "Save Right"
msgstr ""
#: tfrmdiffer.actsaveright.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHT.HINT"
msgid "Save Right"
msgstr ""
#: tfrmdiffer.actsaverightas.caption
msgctxt "tfrmdiffer.actsaverightas.caption"
msgid "Save Right As..."
msgstr ""
#: tfrmdiffer.actsaverightas.hint
msgctxt "TFRMDIFFER.ACTSAVERIGHTAS.HINT"
msgid "Save Right As..."
msgstr ""
#: tfrmdiffer.actstartcompare.caption
msgctxt "tfrmdiffer.actstartcompare.caption"
msgid "Compare"
msgstr ""
#: tfrmdiffer.actstartcompare.hint
msgctxt "TFRMDIFFER.ACTSTARTCOMPARE.HINT"
msgid "Compare"
msgstr ""
#: tfrmdiffer.btnleftencoding.hint
msgctxt "tfrmdiffer.btnleftencoding.hint"
msgid "Encoding"
msgstr ""
#: tfrmdiffer.btnrightencoding.hint
msgctxt "TFRMDIFFER.BTNRIGHTENCODING.HINT"
msgid "Encoding"
msgstr ""
#: tfrmdiffer.caption
msgid "Compare files"
msgstr ""
#: tfrmdiffer.midivider1.caption
msgctxt "TFRMDIFFER.MIDIVIDER1.CAPTION"
msgid "-"
msgstr ""
#: tfrmdiffer.midivider10.caption
msgctxt "TFRMDIFFER.MIDIVIDER10.CAPTION"
msgid "-"
msgstr ""
#: tfrmdiffer.midivider2.caption
msgctxt "TFRMDIFFER.MIDIVIDER2.CAPTION"
msgid "-"
msgstr ""
#: tfrmdiffer.midivider3.caption
msgctxt "TFRMDIFFER.MIDIVIDER3.CAPTION"
msgid "-"
msgstr ""
#: tfrmdiffer.midivider4.caption
msgctxt "TFRMDIFFER.MIDIVIDER4.CAPTION"
msgid "-"
msgstr ""
#: tfrmdiffer.midivider5.caption
msgctxt "TFRMDIFFER.MIDIVIDER5.CAPTION"
msgid "-"
msgstr ""
#: tfrmdiffer.midivider6.caption
msgctxt "TFRMDIFFER.MIDIVIDER6.CAPTION"
msgid "-"
msgstr ""
#: tfrmdiffer.midivider7.caption
msgctxt "tfrmdiffer.midivider7.caption"
msgid "-"
msgstr ""
#: tfrmdiffer.midivider8.caption
msgctxt "TFRMDIFFER.MIDIVIDER8.CAPTION"
msgid "-"
msgstr ""
#: tfrmdiffer.midivider9.caption
msgctxt "TFRMDIFFER.MIDIVIDER9.CAPTION"
msgid "-"
msgstr ""
#: tfrmdiffer.miencodingleft.caption
msgid "&Left"
msgstr ""
#: tfrmdiffer.miencodingright.caption
msgid "&Right"
msgstr ""
#: tfrmdiffer.miseparator1.caption
msgctxt "TFRMDIFFER.MISEPARATOR1.CAPTION"
msgid "-"
msgstr ""
#: tfrmdiffer.miseparator2.caption
msgctxt "TFRMDIFFER.MISEPARATOR2.CAPTION"
msgid "-"
msgstr ""
#: tfrmdiffer.mnuactions.caption
msgid "&Actions"
msgstr ""
#: tfrmdiffer.mnuedit.caption
msgctxt "TFRMDIFFER.MNUEDIT.CAPTION"
msgid "&Edit"
msgstr ""
#: tfrmdiffer.mnuencoding.caption
msgctxt "tfrmdiffer.mnuencoding.caption"
msgid "En&coding"
msgstr ""
#: tfrmdiffer.mnufile.caption
msgctxt "tfrmdiffer.mnufile.caption"
msgid "&File"
msgstr ""
#: tfrmdiffer.mnuoptions.caption
msgid "&Options"
msgstr ""
#: tfrmedithotkey.btnaddshortcut.hint
msgid "Add new shortcut to sequence"
msgstr ""
#: tfrmedithotkey.btncancel.caption
msgctxt "TFRMEDITHOTKEY.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmedithotkey.btnok.caption
msgctxt "TFRMEDITHOTKEY.BTNOK.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmedithotkey.btnremoveshortcut.hint
msgid "Remove last shortcut from sequence"
msgstr ""
#: tfrmedithotkey.btnselectfromlist.hint
msgid "Select shortcut from list of remaining free available keys"
msgstr ""
#: tfrmedithotkey.cghkcontrols.caption
msgid "Only for these controls"
msgstr ""
#: tfrmedithotkey.lblparameters.caption
msgid "&Parameters (each in a separate line):"
msgstr ""
#: tfrmedithotkey.lblshortcuts.caption
msgid "Shortcuts:"
msgstr ""
#: tfrmeditor.actabout.caption
msgctxt "TFRMEDITOR.ACTABOUT.CAPTION"
msgid "About"
msgstr ""
#: tfrmeditor.actabout.hint
msgctxt "TFRMEDITOR.ACTABOUT.HINT"
msgid "About"
msgstr ""
#: tfrmeditor.actconfhigh.caption
msgid "&Configuration"
msgstr ""
#: tfrmeditor.actconfhigh.hint
msgctxt "tfrmeditor.actconfhigh.hint"
msgid "Configuration"
msgstr ""
#: tfrmeditor.acteditcopy.caption
msgctxt "TFRMEDITOR.ACTEDITCOPY.CAPTION"
msgid "Copy"
msgstr ""
#: tfrmeditor.acteditcopy.hint
msgctxt "TFRMEDITOR.ACTEDITCOPY.HINT"
msgid "Copy"
msgstr ""
#: tfrmeditor.acteditcut.caption
msgctxt "TFRMEDITOR.ACTEDITCUT.CAPTION"
msgid "Cut"
msgstr ""
#: tfrmeditor.acteditcut.hint
msgctxt "TFRMEDITOR.ACTEDITCUT.HINT"
msgid "Cut"
msgstr ""
#: tfrmeditor.acteditdelete.caption
msgctxt "TFRMEDITOR.ACTEDITDELETE.CAPTION"
msgid "Delete"
msgstr ""
#: tfrmeditor.acteditdelete.hint
msgctxt "TFRMEDITOR.ACTEDITDELETE.HINT"
msgid "Delete"
msgstr ""
#: tfrmeditor.acteditfind.caption
msgctxt "tfrmeditor.acteditfind.caption"
msgid "&Find"
msgstr ""
#: tfrmeditor.acteditfind.hint
msgctxt "tfrmeditor.acteditfind.hint"
msgid "Find"
msgstr ""
#: tfrmeditor.acteditfindnext.caption
msgctxt "tfrmeditor.acteditfindnext.caption"
msgid "Find next"
msgstr ""
#: tfrmeditor.acteditfindnext.hint
msgctxt "TFRMEDITOR.ACTEDITFINDNEXT.HINT"
msgid "Find next"
msgstr ""
#: tfrmeditor.acteditfindprevious.caption
msgctxt "tfrmeditor.acteditfindprevious.caption"
msgid "Find previous"
msgstr ""
#: tfrmeditor.acteditgotoline.caption
msgid "Goto Line..."
msgstr ""
#: tfrmeditor.acteditlineendcr.caption
msgctxt "tfrmeditor.acteditlineendcr.caption"
msgid "Mac (CR)"
msgstr ""
#: tfrmeditor.acteditlineendcr.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCR.HINT"
msgid "Mac (CR)"
msgstr ""
#: tfrmeditor.acteditlineendcrlf.caption
msgctxt "tfrmeditor.acteditlineendcrlf.caption"
msgid "Windows (CRLF)"
msgstr ""
#: tfrmeditor.acteditlineendcrlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDCRLF.HINT"
msgid "Windows (CRLF)"
msgstr ""
#: tfrmeditor.acteditlineendlf.caption
msgctxt "tfrmeditor.acteditlineendlf.caption"
msgid "Unix (LF)"
msgstr ""
#: tfrmeditor.acteditlineendlf.hint
msgctxt "TFRMEDITOR.ACTEDITLINEENDLF.HINT"
msgid "Unix (LF)"
msgstr ""
#: tfrmeditor.acteditpaste.caption
msgctxt "TFRMEDITOR.ACTEDITPASTE.CAPTION"
msgid "Paste"
msgstr ""
#: tfrmeditor.acteditpaste.hint
msgctxt "TFRMEDITOR.ACTEDITPASTE.HINT"
msgid "Paste"
msgstr ""
#: tfrmeditor.acteditredo.caption
msgctxt "TFRMEDITOR.ACTEDITREDO.CAPTION"
msgid "Redo"
msgstr ""
#: tfrmeditor.acteditredo.hint
msgctxt "TFRMEDITOR.ACTEDITREDO.HINT"
msgid "Redo"
msgstr ""
#: tfrmeditor.acteditrplc.caption
msgid "&Replace"
msgstr ""
#: tfrmeditor.acteditrplc.hint
msgctxt "tfrmeditor.acteditrplc.hint"
msgid "Replace"
msgstr ""
#: tfrmeditor.acteditselectall.caption
msgid "Select&All"
msgstr ""
#: tfrmeditor.acteditselectall.hint
msgctxt "tfrmeditor.acteditselectall.hint"
msgid "Select All"
msgstr ""
#: tfrmeditor.acteditundo.caption
msgctxt "TFRMEDITOR.ACTEDITUNDO.CAPTION"
msgid "Undo"
msgstr ""
#: tfrmeditor.acteditundo.hint
msgctxt "TFRMEDITOR.ACTEDITUNDO.HINT"
msgid "Undo"
msgstr ""
#: tfrmeditor.actfileclose.caption
msgctxt "TFRMEDITOR.ACTFILECLOSE.CAPTION"
msgid "&Close"
msgstr ""
#: tfrmeditor.actfileclose.hint
msgctxt "tfrmeditor.actfileclose.hint"
msgid "Close"
msgstr ""
#: tfrmeditor.actfileexit.caption
msgctxt "TFRMEDITOR.ACTFILEEXIT.CAPTION"
msgid "E&xit"
msgstr ""
#: tfrmeditor.actfileexit.hint
msgctxt "tfrmeditor.actfileexit.hint"
msgid "Exit"
msgstr ""
#: tfrmeditor.actfilenew.caption
msgid "&New"
msgstr ""
#: tfrmeditor.actfilenew.hint
msgctxt "tfrmeditor.actfilenew.hint"
msgid "New"
msgstr ""
#: tfrmeditor.actfileopen.caption
msgid "&Open"
msgstr ""
#: tfrmeditor.actfileopen.hint
msgctxt "tfrmeditor.actfileopen.hint"
msgid "Open"
msgstr ""
#: tfrmeditor.actfilesave.caption
msgctxt "tfrmeditor.actfilesave.caption"
msgid "&Save"
msgstr ""
#: tfrmeditor.actfilesave.hint
msgctxt "TFRMEDITOR.ACTFILESAVE.HINT"
msgid "Save"
msgstr ""
#: tfrmeditor.actfilesaveas.caption
msgid "Save &As..."
msgstr ""
#: tfrmeditor.actfilesaveas.hint
msgid "Save As"
msgstr ""
#: tfrmeditor.actsaveall.caption
msgid "Sa&ve All"
msgstr ""
#: tfrmeditor.actsaveall.hint
msgid "Save All"
msgstr ""
#: tfrmeditor.caption
msgctxt "tfrmeditor.caption"
msgid "Editor"
msgstr ""
#: tfrmeditor.help1.caption
msgctxt "tfrmeditor.help1.caption"
msgid "&Help"
msgstr ""
#: tfrmeditor.menuitem1.caption
msgctxt "TFRMEDITOR.MENUITEM1.CAPTION"
msgid "-"
msgstr ""
#: tfrmeditor.midiv.caption
msgctxt "TFRMEDITOR.MIDIV.CAPTION"
msgid "-"
msgstr ""
#: tfrmeditor.miedit.caption
msgctxt "TFRMEDITOR.MIEDIT.CAPTION"
msgid "&Edit"
msgstr ""
#: tfrmeditor.miencoding.caption
msgctxt "TFRMEDITOR.MIENCODING.CAPTION"
msgid "En&coding"
msgstr ""
#: tfrmeditor.miencodingin.caption
msgid "Open as"
msgstr ""
#: tfrmeditor.miencodingout.caption
msgctxt "tfrmeditor.miencodingout.caption"
msgid "Save as"
msgstr ""
#: tfrmeditor.mifile.caption
msgctxt "TFRMEDITOR.MIFILE.CAPTION"
msgid "&File"
msgstr ""
#: tfrmeditor.mihighlight.caption
msgid "Syntax highlight"
msgstr ""
#: tfrmeditor.milineendtype.caption
msgid "End Of Line"
msgstr ""
#: tfrmeditor.miseparator1.caption
msgctxt "TFRMEDITOR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr ""
#: tfrmeditor.miseparator2.caption
msgctxt "TFRMEDITOR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr ""
#: tfrmeditor.n1.caption
msgctxt "TFRMEDITOR.N1.CAPTION"
msgid "-"
msgstr ""
#: tfrmeditor.n3.caption
msgctxt "TFRMEDITOR.N3.CAPTION"
msgid "-"
msgstr ""
#: tfrmeditor.n4.caption
msgctxt "TFRMEDITOR.N4.CAPTION"
msgid "-"
msgstr ""
#: tfrmeditor.n5.caption
msgctxt "TFRMEDITOR.N5.CAPTION"
msgid "-"
msgstr ""
#: tfrmeditsearchreplace.buttonpanel.cancelbutton.caption
msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.CANCELBUTTON.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmeditsearchreplace.buttonpanel.okbutton.caption
msgctxt "TFRMEDITSEARCHREPLACE.BUTTONPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmeditsearchreplace.cbsearchcasesensitive.caption
msgid "C&ase sensitivity"
msgstr ""
#: tfrmeditsearchreplace.cbsearchfromcursor.caption
msgid "S&earch from caret"
msgstr ""
#: tfrmeditsearchreplace.cbsearchregexp.caption
msgid "&Regular expressions"
msgstr ""
#: tfrmeditsearchreplace.cbsearchselectedonly.caption
msgid "Selected &text only"
msgstr ""
#: tfrmeditsearchreplace.cbsearchwholewords.caption
msgid "&Whole words only"
msgstr ""
#: tfrmeditsearchreplace.gbsearchoptions.caption
msgid "Option"
msgstr ""
#: tfrmeditsearchreplace.lblreplacewith.caption
msgid "&Replace with:"
msgstr ""
#: tfrmeditsearchreplace.lblsearchfor.caption
msgid "&Search for:"
msgstr ""
#: tfrmeditsearchreplace.rgsearchdirection.caption
msgid "Direction"
msgstr ""
#: tfrmextractdlg.caption
msgid "Unpack files"
msgstr ""
#: tfrmextractdlg.cbextractpath.caption
msgid "&Unpack path names if stored with files"
msgstr ""
#: tfrmextractdlg.cbfilemask.text
msgctxt "tfrmextractdlg.cbfilemask.text"
msgid "*.*"
msgstr ""
#: tfrmextractdlg.cbinseparatefolder.caption
msgid "Unpack each archive to a &separate subdir (name of the archive)"
msgstr ""
#: tfrmextractdlg.cboverwrite.caption
msgid "O&verwrite existing files"
msgstr ""
#: tfrmextractdlg.lblextractto.caption
msgid "To the &directory:"
msgstr ""
#: tfrmextractdlg.lblfilemask.caption
msgid "&Extract files matching file mask:"
msgstr ""
#: tfrmextractdlg.lblpassword.caption
msgid "&Password for encrypted files:"
msgstr ""
#: tfrmfileexecuteyourself.btnclose.caption
msgctxt "TFRMFILEEXECUTEYOURSELF.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr ""
#: tfrmfileexecuteyourself.caption
msgid "Wait..."
msgstr ""
#: tfrmfileexecuteyourself.lblfilename.caption
msgid "File name:"
msgstr ""
#: tfrmfileexecuteyourself.lblfrompath.caption
msgctxt "tfrmfileexecuteyourself.lblfrompath.caption"
msgid "From:"
msgstr ""
#: tfrmfileexecuteyourself.lblprompt.caption
msgid "Click on Close when the temporary file can be deleted!"
msgstr ""
#: tfrmfileop.btncancel.caption
msgctxt "TFRMFILEOP.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmfileop.btnminimizetopanel.caption
msgid "&To panel"
msgstr ""
#: tfrmfileop.btnviewoperations.caption
msgid "&View all"
msgstr ""
#: tfrmfileop.lblcurrentoperation.caption
msgid "Current operation:"
msgstr ""
#: tfrmfileop.lblfrom.caption
msgctxt "TFRMFILEOP.LBLFROM.CAPTION"
msgid "From:"
msgstr ""
#: tfrmfileop.lblto.caption
msgid "To:"
msgstr ""
#: tfrmfileproperties.btnclose.caption
msgctxt "TFRMFILEPROPERTIES.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr ""
#: tfrmfileproperties.btnsetproperties.caption
msgid "&Set properties"
msgstr ""
#: tfrmfileproperties.btnsetpropertiestoallfiles.caption
msgid "Set to &all selected files"
msgstr ""
#: tfrmfileproperties.btnskipfile.caption
msgid "Ski&p this file"
msgstr ""
#: tfrmfileproperties.caption
msgctxt "tfrmfileproperties.caption"
msgid "Properties"
msgstr ""
#: tfrmfileproperties.cbsgid.caption
msgctxt "TFRMFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr ""
#: tfrmfileproperties.cbsticky.caption
msgctxt "TFRMFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr ""
#: tfrmfileproperties.cbsuid.caption
msgctxt "TFRMFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr ""
#: tfrmfileproperties.chkexecutable.caption
msgid "Allow &executing file as program"
msgstr ""
#: tfrmfileproperties.gbowner.caption
msgctxt "TFRMFILEPROPERTIES.GBOWNER.CAPTION"
msgid "Owner"
msgstr ""
#: tfrmfileproperties.lblattrbitsstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr ""
#: tfrmfileproperties.lblattrgroupstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr ""
#: tfrmfileproperties.lblattrotherstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr ""
#: tfrmfileproperties.lblattrownerstr.caption
msgctxt "TFRMFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr ""
#: tfrmfileproperties.lblattrtext.caption
msgctxt "tfrmfileproperties.lblattrtext.caption"
msgid "-----------"
msgstr ""
#: tfrmfileproperties.lblattrtextstr.caption
msgctxt "tfrmfileproperties.lblattrtextstr.caption"
msgid "Text:"
msgstr ""
#: tfrmfileproperties.lblcontains.caption
msgctxt "TFRMFILEPROPERTIES.LBLCONTAINS.CAPTION"
msgid "???"
msgstr ""
#: tfrmfileproperties.lblcontainsstr.caption
msgid "Contains:"
msgstr ""
#: tfrmfileproperties.lblexec.caption
msgctxt "TFRMFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr ""
#: tfrmfileproperties.lblexecutable.caption
msgid "Execute:"
msgstr ""
#: tfrmfileproperties.lblfile.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILE.CAPTION"
msgid "File name"
msgstr ""
#: tfrmfileproperties.lblfilename.caption
msgctxt "TFRMFILEPROPERTIES.LBLFILENAME.CAPTION"
msgid "???"
msgstr ""
#: tfrmfileproperties.lblfilestr.caption
msgctxt "tfrmfileproperties.lblfilestr.caption"
msgid "File name"
msgstr ""
#: tfrmfileproperties.lblfolder.caption
msgctxt "TFRMFILEPROPERTIES.LBLFOLDER.CAPTION"
msgid "???"
msgstr ""
#: tfrmfileproperties.lblfolderstr.caption
msgctxt "tfrmfileproperties.lblfolderstr.caption"
msgid "Path:"
msgstr ""
#: tfrmfileproperties.lblgroupstr.caption
msgid "&Group"
msgstr ""
#: tfrmfileproperties.lbllastaccess.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTACCESS.CAPTION"
msgid "???"
msgstr ""
#: tfrmfileproperties.lbllastaccessstr.caption
msgid "Last access:"
msgstr ""
#: tfrmfileproperties.lbllastmodif.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTMODIF.CAPTION"
msgid "???"
msgstr ""
#: tfrmfileproperties.lbllastmodifstr.caption
msgid "Last modification:"
msgstr ""
#: tfrmfileproperties.lbllaststchange.caption
msgctxt "TFRMFILEPROPERTIES.LBLLASTSTCHANGE.CAPTION"
msgid "???"
msgstr ""
#: tfrmfileproperties.lbllaststchangestr.caption
msgid "Last status change:"
msgstr ""
#: tfrmfileproperties.lbloctal.caption
msgctxt "tfrmfileproperties.lbloctal.caption"
msgid "Octal:"
msgstr ""
#: tfrmfileproperties.lblownerstr.caption
msgid "O&wner"
msgstr ""
#: tfrmfileproperties.lblread.caption
msgctxt "TFRMFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr ""
#: tfrmfileproperties.lblsize.caption
msgctxt "TFRMFILEPROPERTIES.LBLSIZE.CAPTION"
msgid "???"
msgstr ""
#: tfrmfileproperties.lblsizestr.caption
msgctxt "tfrmfileproperties.lblsizestr.caption"
msgid "Size:"
msgstr ""
#: tfrmfileproperties.lblsymlink.caption
msgctxt "TFRMFILEPROPERTIES.LBLSYMLINK.CAPTION"
msgid "???"
msgstr ""
#: tfrmfileproperties.lblsymlinkstr.caption
msgid "Symlink to:"
msgstr ""
#: tfrmfileproperties.lbltype.caption
msgctxt "TFRMFILEPROPERTIES.LBLTYPE.CAPTION"
msgid "???"
msgstr ""
#: tfrmfileproperties.lbltypestr.caption
msgid "Type:"
msgstr ""
#: tfrmfileproperties.lblwrite.caption
msgctxt "TFRMFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr ""
#: tfrmfileproperties.sgimage.columns[0].title.caption
msgctxt "tfrmfileproperties.sgimage.columns[0].title.caption"
msgid "Name"
msgstr ""
#: tfrmfileproperties.sgimage.columns[1].title.caption
msgctxt "tfrmfileproperties.sgimage.columns[1].title.caption"
msgid "Value"
msgstr ""
#: tfrmfileproperties.tsattributes.caption
msgctxt "tfrmfileproperties.tsattributes.caption"
msgid "Attributes"
msgstr ""
#: tfrmfileproperties.tsimage.caption
msgid "Image"
msgstr ""
#: tfrmfileproperties.tsproperties.caption
msgctxt "TFRMFILEPROPERTIES.TSPROPERTIES.CAPTION"
msgid "Properties"
msgstr ""
#: tfrmfinddlg.actcancel.caption
msgctxt "TFRMFINDDLG.ACTCANCEL.CAPTION"
msgid "C&ancel"
msgstr ""
#: tfrmfinddlg.actcancelclose.caption
msgid "Cancel search and close window"
msgstr ""
#: tfrmfinddlg.actclose.caption
msgctxt "TFRMFINDDLG.ACTCLOSE.CAPTION"
msgid "&Close"
msgstr ""
#: tfrmfinddlg.actconfigfilesearchhotkeys.caption
msgctxt "TFRMFINDDLG.ACTCONFIGFILESEARCHHOTKEYS.CAPTION"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmfinddlg.actedit.caption
msgctxt "tfrmfinddlg.actedit.caption"
msgid "&Edit"
msgstr ""
#: tfrmfinddlg.actfeedtolistbox.caption
msgid "Feed to &listbox"
msgstr ""
#: tfrmfinddlg.actfreefrommem.caption
msgid "Cancel search, close and free from memory"
msgstr ""
#: tfrmfinddlg.actfreefrommemallothers.caption
msgid "For all other \"Find files\", cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.actgotofile.caption
msgid "&Go to file"
msgstr ""
#: tfrmfinddlg.actintellifocus.caption
msgctxt "TFRMFINDDLG.ACTINTELLIFOCUS.CAPTION"
msgid "Find Data"
msgstr ""
#: tfrmfinddlg.actlastsearch.caption
msgid "&Last search"
msgstr ""
#: tfrmfinddlg.actnewsearch.caption
msgid "&New search"
msgstr ""
#: tfrmfinddlg.actnewsearchclearfilters.caption
msgid "New search (clear filters)"
msgstr ""
#: tfrmfinddlg.actpageadvanced.caption
msgid "Go to page \"Advanced\""
msgstr ""
#: tfrmfinddlg.actpageloadsave.caption
msgid "Go to page \"Load/Save\""
msgstr ""
#: tfrmfinddlg.actpageplugins.caption
msgid "Go to page \"Plugins\""
msgstr ""
#: tfrmfinddlg.actpageresults.caption
msgid "Go to page \"Results\""
msgstr ""
#: tfrmfinddlg.actpagestandard.caption
msgid "Go to page \"Standard\""
msgstr ""
#: tfrmfinddlg.actstart.caption
msgctxt "tfrmfinddlg.actstart.caption"
msgid "&Start"
msgstr ""
#: tfrmfinddlg.actview.caption
msgctxt "tfrmfinddlg.actview.caption"
msgid "&View"
msgstr ""
#: tfrmfinddlg.btnaddattribute.caption
msgctxt "tfrmfinddlg.btnaddattribute.caption"
msgid "&Add"
msgstr ""
#: tfrmfinddlg.btnattrshelp.caption
msgctxt "TFRMFINDDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr ""
#: tfrmfinddlg.btnsavetemplate.caption
msgctxt "TFRMFINDDLG.BTNSAVETEMPLATE.CAPTION"
msgid "&Save"
msgstr ""
#: tfrmfinddlg.btnsearchdelete.caption
msgctxt "TFRMFINDDLG.BTNSEARCHDELETE.CAPTION"
msgid "&Delete"
msgstr ""
#: tfrmfinddlg.btnsearchload.caption
msgid "L&oad"
msgstr ""
#: tfrmfinddlg.btnsearchsave.caption
msgid "S&ave"
msgstr ""
#: tfrmfinddlg.btnsearchsavewithstartingpath.caption
msgid "Sa&ve with \"Start in directory\""
msgstr ""
#: tfrmfinddlg.btnsearchsavewithstartingpath.hint
msgid "If saved then \"Start in directory\" will be restored when loading template. Use it if you want to fix searching to a certain directory"
msgstr ""
#: tfrmfinddlg.btnusetemplate.caption
msgid "Use template"
msgstr ""
#: tfrmfinddlg.caption
msgctxt "tfrmfinddlg.caption"
msgid "Find files"
msgstr ""
#: tfrmfinddlg.cbcasesens.caption
msgid "Case sens&itive"
msgstr ""
#: tfrmfinddlg.cbdatefrom.caption
msgid "&Date from:"
msgstr ""
#: tfrmfinddlg.cbdateto.caption
msgid "Dat&e to:"
msgstr ""
#: tfrmfinddlg.cbfilesizefrom.caption
msgid "S&ize from:"
msgstr ""
#: tfrmfinddlg.cbfilesizeto.caption
msgid "Si&ze to:"
msgstr ""
#: tfrmfinddlg.cbfindinarchive.caption
msgid "Search in &archives"
msgstr ""
#: tfrmfinddlg.cbfindtext.caption
msgid "Find &text in file"
msgstr ""
#: tfrmfinddlg.cbfollowsymlinks.caption
msgid "Follow s&ymlinks"
msgstr ""
#: tfrmfinddlg.cbnotcontainingtext.caption
msgid "Find files N&OT containing the text"
msgstr ""
#: tfrmfinddlg.cbnotolderthan.caption
msgid "N&ot older than:"
msgstr ""
#: tfrmfinddlg.cbopenedtabs.caption
msgid "Opened tabs"
msgstr ""
#: tfrmfinddlg.cbpartialnamesearch.caption
msgid "Searc&h for part of file name"
msgstr ""
#: tfrmfinddlg.cbregexp.caption
msgid "&Regular expression"
msgstr ""
#: tfrmfinddlg.cbreplacetext.caption
msgid "Re&place by"
msgstr ""
#: tfrmfinddlg.cbselectedfiles.caption
msgid "Selected directories and &files"
msgstr ""
#: tfrmfinddlg.cbtextregexp.caption
msgid "Regular &expression"
msgstr ""
#: tfrmfinddlg.cbtimefrom.caption
msgid "&Time from:"
msgstr ""
#: tfrmfinddlg.cbtimeto.caption
msgid "Ti&me to:"
msgstr ""
#: tfrmfinddlg.cbuseplugin.caption
msgid "&Use search plugin:"
msgstr ""
#: tfrmfinddlg.cmbexcludedirectories.hint
msgid "Enter directories names that should be excluded from search separated with \";\""
msgstr ""
#: tfrmfinddlg.cmbexcludefiles.hint
msgid "Enter files names that should be excluded from search separated with \";\""
msgstr ""
#: tfrmfinddlg.cmbfindfilemask.hint
msgid "Enter files names separated with \";\""
msgstr ""
#: tfrmfinddlg.cmbfindfilemask.text
msgctxt "tfrmfinddlg.cmbfindfilemask.text"
msgid "*"
msgstr ""
#: tfrmfinddlg.gbdirectories.caption
msgctxt "tfrmfinddlg.gbdirectories.caption"
msgid "Directories"
msgstr ""
#: tfrmfinddlg.gbfiles.caption
msgctxt "tfrmfinddlg.gbfiles.caption"
msgid "Files"
msgstr ""
#: tfrmfinddlg.gbfinddata.caption
msgctxt "tfrmfinddlg.gbfinddata.caption"
msgid "Find Data"
msgstr ""
#: tfrmfinddlg.lblattributes.caption
msgid "Attri&butes"
msgstr ""
#: tfrmfinddlg.lblencoding.caption
msgid "Encodin&g:"
msgstr ""
#: tfrmfinddlg.lblexcludedirectories.caption
msgid "E&xclude subdirectories"
msgstr ""
#: tfrmfinddlg.lblexcludefiles.caption
msgid "&Exclude files"
msgstr ""
#: tfrmfinddlg.lblfindfilemask.caption
msgid "&File mask"
msgstr ""
#: tfrmfinddlg.lblfindpathstart.caption
msgid "Start in &directory"
msgstr ""
#: tfrmfinddlg.lblsearchdepth.caption
msgid "Search su&bdirectories:"
msgstr ""
#: tfrmfinddlg.lbltemplateheader.caption
msgid "&Previous searches:"
msgstr ""
#: tfrmfinddlg.miaction.caption
msgid "&Action"
msgstr ""
#: tfrmfinddlg.mifreefrommemallothers.caption
msgid "For all others, cancel, close and free from memory"
msgstr ""
#: tfrmfinddlg.miopeninnewtab.caption
msgid "Open In New Tab(s)"
msgstr ""
#: tfrmfinddlg.mioptions.caption
msgctxt "TFRMFINDDLG.MIOPTIONS.CAPTION"
msgid "Options"
msgstr ""
#: tfrmfinddlg.miremovefromllist.caption
msgid "Remove from list"
msgstr ""
#: tfrmfinddlg.miresult.caption
msgid "&Result"
msgstr ""
#: tfrmfinddlg.miseparator1.caption
msgctxt "TFRMFINDDLG.MISEPARATOR1.CAPTION"
msgid "-"
msgstr ""
#: tfrmfinddlg.miseparator2.caption
msgctxt "TFRMFINDDLG.MISEPARATOR2.CAPTION"
msgid "-"
msgstr ""
#: tfrmfinddlg.mishowallfound.caption
msgid "Show all found items"
msgstr ""
#: tfrmfinddlg.mishowineditor.caption
msgid "Show In Editor"
msgstr ""
#: tfrmfinddlg.mishowinviewer.caption
msgid "Show In Viewer"
msgstr ""
#: tfrmfinddlg.miviewtab.caption
msgctxt "TFRMFINDDLG.MIVIEWTAB.CAPTION"
msgid "&View"
msgstr ""
#: tfrmfinddlg.tsadvanced.caption
msgid "Advanced"
msgstr ""
#: tfrmfinddlg.tsloadsave.caption
msgid "Load/Save"
msgstr ""
#: tfrmfinddlg.tsplugins.caption
msgctxt "tfrmfinddlg.tsplugins.caption"
msgid "Plugins"
msgstr ""
#: tfrmfinddlg.tsresults.caption
msgid "Results"
msgstr ""
#: tfrmfinddlg.tsstandard.caption
msgid "Standard"
msgstr ""
#: tfrmfindview.btnclose.caption
msgctxt "TFRMFINDVIEW.BTNCLOSE.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmfindview.btnfind.caption
msgctxt "TFRMFINDVIEW.BTNFIND.CAPTION"
msgid "&Find"
msgstr ""
#: tfrmfindview.caption
msgctxt "TFRMFINDVIEW.CAPTION"
msgid "Find"
msgstr ""
#: tfrmfindview.cbcasesens.caption
msgid "C&ase sensitive"
msgstr ""
#: tfrmhardlink.btncancel.caption
msgctxt "TFRMHARDLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmhardlink.btnok.caption
msgctxt "TFRMHARDLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmhardlink.caption
msgid "Create hard link"
msgstr ""
#: tfrmhardlink.lblexistingfile.caption
msgctxt "tfrmhardlink.lblexistingfile.caption"
msgid "&Destination that the link will point to"
msgstr ""
#: tfrmhardlink.lbllinktocreate.caption
msgctxt "tfrmhardlink.lbllinktocreate.caption"
msgid "&Link name"
msgstr ""
#: tfrmhotdirexportimport.btnselectall.caption
msgctxt "tfrmhotdirexportimport.btnselectall.caption"
msgid "Import all!"
msgstr ""
#: tfrmhotdirexportimport.btnselectiondone.caption
msgctxt "tfrmhotdirexportimport.btnselectiondone.caption"
msgid "Import selected"
msgstr ""
#: tfrmhotdirexportimport.caption
msgid "Select the entries your want to import"
msgstr ""
#: tfrmhotdirexportimport.lbhint.caption
msgid "When clicking a sub-menu, it will select the whole menu"
msgstr ""
#: tfrmhotdirexportimport.lblhintholdcontrol.caption
msgid "Hold CTRL and click entries to select multiple ones"
msgstr ""
#: tfrmlinker.btnsave.caption
msgctxt "tfrmlinker.btnsave.caption"
msgid "..."
msgstr ""
#: tfrmlinker.caption
msgid "Linker"
msgstr ""
#: tfrmlinker.gbsaveto.caption
msgid "Save to..."
msgstr ""
#: tfrmlinker.grbxcontrol.caption
msgid "Item"
msgstr ""
#: tfrmlinker.lblfilename.caption
msgid "&File name"
msgstr ""
#: tfrmlinker.spbtndown.caption
msgid "Do&wn"
msgstr ""
#: tfrmlinker.spbtndown.hint
msgid "Down"
msgstr ""
#: tfrmlinker.spbtnrem.caption
msgctxt "tfrmlinker.spbtnrem.caption"
msgid "&Remove"
msgstr ""
#: tfrmlinker.spbtnrem.hint
msgctxt "TFRMLINKER.SPBTNREM.HINT"
msgid "Delete"
msgstr ""
#: tfrmlinker.spbtnup.caption
msgctxt "tfrmlinker.spbtnup.caption"
msgid "&Up"
msgstr ""
#: tfrmlinker.spbtnup.hint
msgid "Up"
msgstr ""
#: tfrmmain.actabout.caption
msgid "&About"
msgstr ""
#: tfrmmain.actaddfilenametocmdline.caption
msgid "Add file name to command line"
msgstr ""
#: tfrmmain.actaddnewsearch.caption
msgid "New search instance..."
msgstr ""
#: tfrmmain.actaddpathandfilenametocmdline.caption
msgid "Add path and file name to command line"
msgstr ""
#: tfrmmain.actaddpathtocmdline.caption
msgid "Copy path to command line"
msgstr ""
#: tfrmmain.actbriefview.caption
msgid "Brief view"
msgstr ""
#: tfrmmain.actbriefview.hint
msgid "Brief View"
msgstr ""
#: tfrmmain.actcalculatespace.caption
msgid "Calculate &Occupied Space"
msgstr ""
#: tfrmmain.actchangedir.caption
msgid "Change directory"
msgstr ""
#: tfrmmain.actchangedirtohome.caption
msgid "Change directory to home"
msgstr ""
#: tfrmmain.actchangedirtoparent.caption
msgid "Change Directory To Parent"
msgstr ""
#: tfrmmain.actchangedirtoroot.caption
msgid "Change directory to root"
msgstr ""
#: tfrmmain.actchecksumcalc.caption
msgid "Calculate Check&sum..."
msgstr ""
#: tfrmmain.actchecksumverify.caption
msgid "&Verify Checksum..."
msgstr ""
#: tfrmmain.actclearlogfile.caption
msgid "Clear log file"
msgstr ""
#: tfrmmain.actclearlogwindow.caption
msgid "Clear log window"
msgstr ""
#: tfrmmain.actclosealltabs.caption
msgid "Close &All Tabs"
msgstr ""
#: tfrmmain.actcloseduplicatetabs.caption
msgid "Close Duplicate Tabs"
msgstr ""
#: tfrmmain.actclosetab.caption
msgid "&Close Tab"
msgstr ""
#: tfrmmain.actcmdlinenext.caption
msgid "Next Command Line"
msgstr ""
#: tfrmmain.actcmdlinenext.hint
msgid "Set command line to next command in history"
msgstr ""
#: tfrmmain.actcmdlineprev.caption
msgid "Previous Command Line"
msgstr ""
#: tfrmmain.actcmdlineprev.hint
msgid "Set command line to previous command in history"
msgstr ""
#: tfrmmain.actcolumnsview.caption
msgid "Full"
msgstr ""
#: tfrmmain.actcolumnsview.hint
msgid "Columns View"
msgstr ""
#: tfrmmain.actcomparecontents.caption
msgid "Compare by &Contents"
msgstr ""
#: tfrmmain.actcomparedirectories.caption
msgctxt "tfrmmain.actcomparedirectories.caption"
msgid "Compare Directories"
msgstr ""
#: tfrmmain.actcomparedirectories.hint
msgctxt "TFRMMAIN.ACTCOMPAREDIRECTORIES.HINT"
msgid "Compare Directories"
msgstr ""
#: tfrmmain.actconfigdirhotlist.caption
msgctxt "tfrmmain.actconfigdirhotlist.caption"
msgid "Configuration of Directory Hotlist"
msgstr ""
#: tfrmmain.actconfigfavoritetabs.caption
msgid "Configuration of Favorite Tabs"
msgstr ""
#: tfrmmain.actconfigfoldertabs.caption
msgid "Configuration of folder tabs"
msgstr ""
#: tfrmmain.actconfighotkeys.caption
msgctxt "tfrmmain.actconfighotkeys.caption"
msgid "Configuration of hot keys"
msgstr ""
#: tfrmmain.actconfigsavesettings.caption
msgid "Save Settings"
msgstr ""
#: tfrmmain.actconfigsearches.caption
msgid "Configuration of searches"
msgstr ""
#: tfrmmain.actconfigtoolbars.caption
msgid "Toolbar..."
msgstr ""
#: tfrmmain.actconfigtreeviewmenus.caption
msgctxt "tfrmmain.actconfigtreeviewmenus.caption"
msgid "Configuration of Tree View Menu"
msgstr ""
#: tfrmmain.actconfigtreeviewmenuscolors.caption
msgctxt "tfrmmain.actconfigtreeviewmenuscolors.caption"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmmain.actcontextmenu.caption
msgid "Show context menu"
msgstr ""
#: tfrmmain.actcopy.caption
msgctxt "TFRMMAIN.ACTCOPY.CAPTION"
msgid "Copy"
msgstr ""
#: tfrmmain.actcopyalltabstoopposite.caption
msgid "Copy all tabs to opposite side"
msgstr ""
#: tfrmmain.actcopyfiledetailstoclip.caption
msgid "Copy all shown &columns"
msgstr ""
#: tfrmmain.actcopyfullnamestoclip.caption
msgid "Copy Filename(s) with Full &Path"
msgstr ""
#: tfrmmain.actcopynamestoclip.caption
msgid "Copy &Filename(s) to Clipboard"
msgstr ""
#: tfrmmain.actcopynoask.caption
msgid "Copy files without asking for confirmation"
msgstr ""
#: tfrmmain.actcopypathnosepoffilestoclip.caption
msgid "Copy Full Path of selected file(s) with no ending dir separator"
msgstr ""
#: tfrmmain.actcopypathoffilestoclip.caption
msgid "Copy Full Path of selected file(s)"
msgstr ""
#: tfrmmain.actcopysamepanel.caption
msgid "Copy to same panel"
msgstr ""
#: tfrmmain.actcopytoclipboard.caption
msgid "&Copy"
msgstr ""
#: tfrmmain.actcountdircontent.caption
msgid "Sho&w Occupied Space"
msgstr ""
#: tfrmmain.actcuttoclipboard.caption
msgid "Cu&t"
msgstr ""
#: tfrmmain.actdebugshowcommandparameters.caption
msgid "Show Command Parameters"
msgstr ""
#: tfrmmain.actdelete.caption
msgctxt "TFRMMAIN.ACTDELETE.CAPTION"
msgid "Delete"
msgstr ""
#: tfrmmain.actdeletesearches.caption
msgid "For all searches, cancel, close and free memory"
msgstr ""
#: tfrmmain.actdirhistory.caption
msgid "Directory history"
msgstr ""
#: tfrmmain.actdirhotlist.caption
msgid "Directory &Hotlist"
msgstr ""
#: tfrmmain.actdoanycmcommand.caption
msgid "Select any command and execute it"
msgstr ""
#: tfrmmain.actedit.caption
msgctxt "TFRMMAIN.ACTEDIT.CAPTION"
msgid "Edit"
msgstr ""
#: tfrmmain.acteditcomment.caption
msgid "Edit Co&mment..."
msgstr ""
#: tfrmmain.acteditnew.caption
msgid "Edit new file"
msgstr ""
#: tfrmmain.acteditpath.caption
msgid "Edit path field above file list"
msgstr ""
#: tfrmmain.actexchange.caption
msgid "Swap &Panels"
msgstr ""
#: tfrmmain.actexecutescript.caption
msgid "Execute Script"
msgstr ""
#: tfrmmain.actexit.caption
msgctxt "TFRMMAIN.ACTEXIT.CAPTION"
msgid "E&xit"
msgstr ""
#: tfrmmain.actextractfiles.caption
msgid "&Extract Files..."
msgstr ""
#: tfrmmain.actfileassoc.caption
msgid "Configuration of File &Associations"
msgstr ""
#: tfrmmain.actfilelinker.caption
msgid "Com&bine Files..."
msgstr ""
#: tfrmmain.actfileproperties.caption
msgid "Show &File Properties"
msgstr ""
#: tfrmmain.actfilespliter.caption
msgid "Spl&it File..."
msgstr ""
#: tfrmmain.actflatview.caption
msgid "&Flat view"
msgstr ""
#: tfrmmain.actfocuscmdline.caption
msgid "Focus command line"
msgstr ""
#: tfrmmain.actfocusswap.caption
msgid "Swap focus"
msgstr ""
#: tfrmmain.actfocusswap.hint
msgid "Switch between left and right file list"
msgstr ""
#: tfrmmain.actgotofirstfile.caption
msgid "Place cursor on first file in list"
msgstr ""
#: tfrmmain.actgotolastfile.caption
msgid "Place cursor on last file in list"
msgstr ""
#: tfrmmain.acthardlink.caption
msgid "Create &Hard Link..."
msgstr ""
#: tfrmmain.acthelpindex.caption
msgid "&Contents"
msgstr ""
#: tfrmmain.acthorizontalfilepanels.caption
msgid "&Horizontal Panels Mode"
msgstr ""
#: tfrmmain.actkeyboard.caption
msgid "&Keyboard"
msgstr ""
#: tfrmmain.actleftbriefview.caption
msgid "Brief view on left panel"
msgstr ""
#: tfrmmain.actleftcolumnsview.caption
msgid "Columns view on left panel"
msgstr ""
#: tfrmmain.actleftequalright.caption
msgid "Left &= Right"
msgstr ""
#: tfrmmain.actleftflatview.caption
msgid "&Flat view on left panel"
msgstr ""
#: tfrmmain.actleftopendrives.caption
msgid "Open left drive list"
msgstr ""
#: tfrmmain.actleftreverseorder.caption
msgid "Re&verse order on left panel"
msgstr ""
#: tfrmmain.actleftsortbyattr.caption
msgid "Sort left panel by &Attributes"
msgstr ""
#: tfrmmain.actleftsortbydate.caption
msgid "Sort left panel by &Date"
msgstr ""
#: tfrmmain.actleftsortbyext.caption
msgid "Sort left panel by &Extension"
msgstr ""
#: tfrmmain.actleftsortbyname.caption
msgid "Sort left panel by &Name"
msgstr ""
#: tfrmmain.actleftsortbysize.caption
msgid "Sort left panel by &Size"
msgstr ""
#: tfrmmain.actleftthumbview.caption
msgid "Thumbnails view on left panel"
msgstr ""
#: tfrmmain.actloadfavoritetabs.caption
msgid "Load tabs from Favorite Tabs"
msgstr ""
#: tfrmmain.actloadselectionfromclip.caption
msgid "Load Selection from Clip&board"
msgstr ""
#: tfrmmain.actloadselectionfromfile.caption
msgid "&Load Selection from File..."
msgstr ""
#: tfrmmain.actloadtabs.caption
msgid "&Load Tabs from File"
msgstr ""
#: tfrmmain.actmakedir.caption
msgid "Create &Directory"
msgstr ""
#: tfrmmain.actmarkcurrentextension.caption
msgid "Select All with the Same E&xtension"
msgstr ""
#: tfrmmain.actmarkcurrentname.caption
msgid "Select all files with same name"
msgstr ""
#: tfrmmain.actmarkcurrentnameext.caption
msgid "Select all files with same name and extension"
msgstr ""
#: tfrmmain.actmarkcurrentpath.caption
msgid "Select all in same path"
msgstr ""
#: tfrmmain.actmarkinvert.caption
msgid "&Invert Selection"
msgstr ""
#: tfrmmain.actmarkmarkall.caption
msgid "&Select All"
msgstr ""
#: tfrmmain.actmarkminus.caption
msgid "Unselect a Gro&up..."
msgstr ""
#: tfrmmain.actmarkplus.caption
msgid "Select a &Group..."
msgstr ""
#: tfrmmain.actmarkunmarkall.caption
msgid "&Unselect All"
msgstr ""
#: tfrmmain.actminimize.caption
msgid "Minimize window"
msgstr ""
#: tfrmmain.actmultirename.caption
msgid "Multi &Rename Tool"
msgstr ""
#: tfrmmain.actnetworkconnect.caption
msgid "Network &Connect..."
msgstr ""
#: tfrmmain.actnetworkdisconnect.caption
msgid "Network &Disconnect"
msgstr ""
#: tfrmmain.actnetworkquickconnect.caption
msgid "Network &Quick Connect..."
msgstr ""
#: tfrmmain.actnewtab.caption
msgid "&New Tab"
msgstr ""
#: tfrmmain.actnextfavoritetabs.caption
msgid "Load the Next Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actnexttab.caption
msgid "Switch to Nex&t Tab"
msgstr ""
#: tfrmmain.actopen.caption
msgctxt "TFRMMAIN.ACTOPEN.CAPTION"
msgid "Open"
msgstr ""
#: tfrmmain.actopenarchive.caption
msgid "Try open archive"
msgstr ""
#: tfrmmain.actopenbar.caption
msgid "Open bar file"
msgstr ""
#: tfrmmain.actopendirinnewtab.caption
msgid "Open &Folder in a New Tab"
msgstr ""
#: tfrmmain.actopenvirtualfilesystemlist.caption
msgid "Open &VFS List"
msgstr ""
#: tfrmmain.actoperationsviewer.caption
msgid "Operations &Viewer"
msgstr ""
#: tfrmmain.actoptions.caption
msgid "&Options..."
msgstr ""
#: tfrmmain.actpackfiles.caption
msgid "&Pack Files..."
msgstr ""
#: tfrmmain.actpanelssplitterperpos.caption
msgid "Set splitter position"
msgstr ""
#: tfrmmain.actpastefromclipboard.caption
msgid "&Paste"
msgstr ""
#: tfrmmain.actpreviousfavoritetabs.caption
msgid "Load the Previous Favorite Tabs in the list"
msgstr ""
#: tfrmmain.actprevtab.caption
msgid "Switch to &Previous Tab"
msgstr ""
#: tfrmmain.actquickfilter.caption
msgid "Quick filter"
msgstr ""
#: tfrmmain.actquicksearch.caption
msgid "Quick search"
msgstr ""
#: tfrmmain.actquickview.caption
msgid "&Quick View Panel"
msgstr ""
#: tfrmmain.actrefresh.caption
msgid "&Refresh"
msgstr ""
#: tfrmmain.actreloadfavoritetabs.caption
msgid "Reload the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrename.caption
msgctxt "tfrmmain.actrename.caption"
msgid "Move"
msgstr ""
#: tfrmmain.actrenamenoask.caption
msgid "Move/Rename files without asking for confirmation"
msgstr ""
#: tfrmmain.actrenameonly.caption
msgctxt "tfrmmain.actrenameonly.caption"
msgid "Rename"
msgstr ""
#: tfrmmain.actrenametab.caption
msgid "&Rename Tab"
msgstr ""
#: tfrmmain.actresavefavoritetabs.caption
msgid "Resave on the last Favorite Tabs loaded"
msgstr ""
#: tfrmmain.actrestoreselection.caption
msgid "&Restore Selection"
msgstr ""
#: tfrmmain.actreverseorder.caption
msgid "Re&verse Order"
msgstr ""
#: tfrmmain.actrightbriefview.caption
msgid "Brief view on right panel"
msgstr ""
#: tfrmmain.actrightcolumnsview.caption
msgid "Columns view on right panel"
msgstr ""
#: tfrmmain.actrightequalleft.caption
msgid "Right &= Left"
msgstr ""
#: tfrmmain.actrightflatview.caption
msgid "&Flat view on right panel"
msgstr ""
#: tfrmmain.actrightopendrives.caption
msgid "Open right drive list"
msgstr ""
#: tfrmmain.actrightreverseorder.caption
msgid "Re&verse order on right panel"
msgstr ""
#: tfrmmain.actrightsortbyattr.caption
msgid "Sort right panel by &Attributes"
msgstr ""
#: tfrmmain.actrightsortbydate.caption
msgid "Sort right panel by &Date"
msgstr ""
#: tfrmmain.actrightsortbyext.caption
msgid "Sort right panel by &Extension"
msgstr ""
#: tfrmmain.actrightsortbyname.caption
msgid "Sort right panel by &Name"
msgstr ""
#: tfrmmain.actrightsortbysize.caption
msgid "Sort right panel by &Size"
msgstr ""
#: tfrmmain.actrightthumbview.caption
msgid "Thumbnails view on right panel"
msgstr ""
#: tfrmmain.actrunterm.caption
msgid "Run &Terminal"
msgstr ""
#: tfrmmain.actsavefavoritetabs.caption
msgid "Save current tabs to a New Favorite Tabs"
msgstr ""
#: tfrmmain.actsaveselection.caption
msgid "Sa&ve Selection"
msgstr ""
#: tfrmmain.actsaveselectiontofile.caption
msgid "Save S&election to File..."
msgstr ""
#: tfrmmain.actsavetabs.caption
msgid "&Save Tabs to File"
msgstr ""
#: tfrmmain.actsearch.caption
msgid "&Search..."
msgstr ""
#: tfrmmain.actsetalltabsoptiondirsinnewtab.caption
msgid "All tabs Locked with Dir Opened in New Tabs"
msgstr ""
#: tfrmmain.actsetalltabsoptionnormal.caption
msgid "Set all tabs to Normal"
msgstr ""
#: tfrmmain.actsetalltabsoptionpathlocked.caption
msgid "Set all tabs to Locked"
msgstr ""
#: tfrmmain.actsetalltabsoptionpathresets.caption
msgid "All tabs Locked with Dir Changes Allowed"
msgstr ""
#: tfrmmain.actsetfileproperties.caption
msgid "Change &Attributes..."
msgstr ""
#: tfrmmain.actsettaboptiondirsinnewtab.caption
msgid "Locked with Directories Opened in New &Tabs"
msgstr ""
#: tfrmmain.actsettaboptionnormal.caption
msgid "&Normal"
msgstr ""
#: tfrmmain.actsettaboptionpathlocked.caption
msgid "&Locked"
msgstr ""
#: tfrmmain.actsettaboptionpathresets.caption
msgid "Locked with &Directory Changes Allowed"
msgstr ""
#: tfrmmain.actshellexecute.caption
msgctxt "TFRMMAIN.ACTSHELLEXECUTE.CAPTION"
msgid "Open"
msgstr ""
#: tfrmmain.actshellexecute.hint
msgid "Open using system associations"
msgstr ""
#: tfrmmain.actshowbuttonmenu.caption
msgid "Show button menu"
msgstr ""
#: tfrmmain.actshowcmdlinehistory.caption
msgid "Show command line history"
msgstr ""
#: tfrmmain.actshowmainmenu.caption
msgid "Menu"
msgstr ""
#: tfrmmain.actshowsysfiles.caption
msgid "Show &Hidden/System Files"
msgstr ""
#: tfrmmain.actsortbyattr.caption
msgid "Sort by &Attributes"
msgstr ""
#: tfrmmain.actsortbydate.caption
msgid "Sort by &Date"
msgstr ""
#: tfrmmain.actsortbyext.caption
msgid "Sort by &Extension"
msgstr ""
#: tfrmmain.actsortbyname.caption
msgid "Sort by &Name"
msgstr ""
#: tfrmmain.actsortbysize.caption
msgid "Sort by &Size"
msgstr ""
#: tfrmmain.actsrcopendrives.caption
msgid "Open drive list"
msgstr ""
#: tfrmmain.actswitchignorelist.caption
msgid "Enable/disable ignore list file to not show file names"
msgstr ""
#: tfrmmain.actsymlink.caption
msgid "Create Symbolic &Link..."
msgstr ""
#: tfrmmain.actsyncdirs.caption
msgid "Synchronize dirs..."
msgstr ""
#: tfrmmain.acttargetequalsource.caption
msgid "Target &= Source"
msgstr ""
#: tfrmmain.acttestarchive.caption
msgid "&Test Archive(s)"
msgstr ""
#: tfrmmain.actthumbnailsview.caption
msgctxt "tfrmmain.actthumbnailsview.caption"
msgid "Thumbnails"
msgstr ""
#: tfrmmain.actthumbnailsview.hint
msgid "Thumbnails View"
msgstr ""
#: tfrmmain.acttogglefullscreenconsole.caption
msgid "Toggle fullscreen mode console"
msgstr ""
#: tfrmmain.acttransferleft.caption
msgid "Transfer dir under cursor to left window"
msgstr ""
#: tfrmmain.acttransferright.caption
msgid "Transfer dir under cursor to right window"
msgstr ""
#: tfrmmain.acttreeview.caption
msgid "&Tree View Panel"
msgstr ""
#: tfrmmain.actuniversalsingledirectsort.caption
msgid "Sort according to parameters"
msgstr ""
#: tfrmmain.actunmarkcurrentextension.caption
msgid "Unselect All with the Same Ex&tension"
msgstr ""
#: tfrmmain.actunmarkcurrentname.caption
msgid "Unselect all files with same name"
msgstr ""
#: tfrmmain.actunmarkcurrentnameext.caption
msgid "Unselect all files with same name and extension"
msgstr ""
#: tfrmmain.actunmarkcurrentpath.caption
msgid "Unselect all in same path"
msgstr ""
#: tfrmmain.actview.caption
msgctxt "TFRMMAIN.ACTVIEW.CAPTION"
msgid "View"
msgstr ""
#: tfrmmain.actviewhistory.caption
msgid "Show history of visited paths for active view"
msgstr ""
#: tfrmmain.actviewhistorynext.caption
msgid "Go to next entry in history"
msgstr ""
#: tfrmmain.actviewhistoryprev.caption
msgid "Go to previous entry in history"
msgstr ""
#: tfrmmain.actviewlogfile.caption
msgid "View log file"
msgstr ""
#: tfrmmain.actviewsearches.caption
msgid "View current search instances"
msgstr ""
#: tfrmmain.actvisithomepage.caption
msgid "&Visit Double Commander Website"
msgstr ""
#: tfrmmain.actwipe.caption
msgid "Wipe"
msgstr ""
#: tfrmmain.actworkwithdirectoryhotlist.caption
msgid "Work with Directory Hotlist and parameters"
msgstr ""
#: tfrmmain.btnf10.caption
msgctxt "TFRMMAIN.BTNF10.CAPTION"
msgid "Exit"
msgstr ""
#: tfrmmain.btnf7.caption
msgctxt "tfrmmain.btnf7.caption"
msgid "Directory"
msgstr ""
#: tfrmmain.btnf8.caption
msgctxt "TFRMMAIN.BTNF8.CAPTION"
msgid "Delete"
msgstr ""
#: tfrmmain.btnf9.caption
msgctxt "tfrmmain.btnf9.caption"
msgid "Terminal"
msgstr ""
#: tfrmmain.btnleftdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNLEFTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr ""
#: tfrmmain.btnleftdirectoryhotlist.hint
msgctxt "tfrmmain.btnleftdirectoryhotlist.hint"
msgid "Directory Hotlist"
msgstr ""
#: tfrmmain.btnleftequalright.caption
msgctxt "tfrmmain.btnleftequalright.caption"
msgid "<"
msgstr ""
#: tfrmmain.btnleftequalright.hint
msgid "Show current directory of the right panel in the left panel"
msgstr ""
#: tfrmmain.btnlefthome.caption
msgctxt "tfrmmain.btnlefthome.caption"
msgid "~"
msgstr ""
#: tfrmmain.btnlefthome.hint
msgid "Go to home directory"
msgstr ""
#: tfrmmain.btnleftroot.caption
msgctxt "tfrmmain.btnleftroot.caption"
msgid "/"
msgstr ""
#: tfrmmain.btnleftroot.hint
msgid "Go to root directory"
msgstr ""
#: tfrmmain.btnleftup.caption
msgctxt "tfrmmain.btnleftup.caption"
msgid ".."
msgstr ""
#: tfrmmain.btnleftup.hint
msgid "Go to parent directory"
msgstr ""
#: tfrmmain.btnrightdirectoryhotlist.caption
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.CAPTION"
msgid "*"
msgstr ""
#: tfrmmain.btnrightdirectoryhotlist.hint
msgctxt "TFRMMAIN.BTNRIGHTDIRECTORYHOTLIST.HINT"
msgid "Directory Hotlist"
msgstr ""
#: tfrmmain.btnrightequalleft.caption
msgctxt "tfrmmain.btnrightequalleft.caption"
msgid ">"
msgstr ""
#: tfrmmain.btnrightequalleft.hint
msgid "Show current directory of the left panel in the right panel"
msgstr ""
#: tfrmmain.btnrighthome.caption
msgctxt "TFRMMAIN.BTNRIGHTHOME.CAPTION"
msgid "~"
msgstr ""
#: tfrmmain.btnrightroot.caption
msgctxt "TFRMMAIN.BTNRIGHTROOT.CAPTION"
msgid "/"
msgstr ""
#: tfrmmain.btnrightup.caption
msgctxt "TFRMMAIN.BTNRIGHTUP.CAPTION"
msgid ".."
msgstr ""
#: tfrmmain.caption
msgctxt "TFRMMAIN.CAPTION"
msgid "Double Commander"
msgstr ""
#: tfrmmain.lblcommandpath.caption
msgctxt "tfrmmain.lblcommandpath.caption"
msgid "Path"
msgstr ""
#: tfrmmain.menuitem2.caption
msgctxt "TFRMMAIN.MENUITEM2.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.mi2080.caption
msgid "&20/80"
msgstr ""
#: tfrmmain.mi3070.caption
msgid "&30/70"
msgstr ""
#: tfrmmain.mi4060.caption
msgid "&40/60"
msgstr ""
#: tfrmmain.mi5050.caption
msgid "&50/50"
msgstr ""
#: tfrmmain.mi6040.caption
msgid "&60/40"
msgstr ""
#: tfrmmain.mi7030.caption
msgid "&70/30"
msgstr ""
#: tfrmmain.mi8020.caption
msgid "&80/20"
msgstr ""
#: tfrmmain.micancel.caption
msgctxt "TFRMMAIN.MICANCEL.CAPTION"
msgid "Cancel"
msgstr ""
#: tfrmmain.micopy.caption
msgid "Copy..."
msgstr ""
#: tfrmmain.mihardlink.caption
msgid "Create link..."
msgstr ""
#: tfrmmain.miline1.caption
msgctxt "TFRMMAIN.MILINE1.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline10.caption
msgctxt "TFRMMAIN.MILINE10.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline11.caption
msgctxt "TFRMMAIN.MILINE11.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline12.caption
msgctxt "TFRMMAIN.MILINE12.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline13.caption
msgctxt "TFRMMAIN.MILINE13.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline14.caption
msgctxt "TFRMMAIN.MILINE14.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline15.caption
msgctxt "TFRMMAIN.MILINE15.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline16.caption
msgctxt "TFRMMAIN.MILINE16.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline17.caption
msgctxt "TFRMMAIN.MILINE17.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline18.caption
msgctxt "TFRMMAIN.MILINE18.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline19.caption
msgctxt "TFRMMAIN.MILINE19.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline2.caption
msgctxt "TFRMMAIN.MILINE2.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline20.caption
msgctxt "TFRMMAIN.MILINE20.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline21.caption
msgctxt "TFRMMAIN.MILINE21.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline22.caption
msgctxt "TFRMMAIN.MILINE22.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline23.caption
msgctxt "TFRMMAIN.MILINE23.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline24.caption
msgctxt "TFRMMAIN.MILINE24.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline25.caption
msgctxt "TFRMMAIN.MILINE25.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline26.caption
msgctxt "TFRMMAIN.MILINE26.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline3.caption
msgctxt "TFRMMAIN.MILINE3.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline32.caption
msgctxt "TFRMMAIN.MILINE32.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline33.caption
msgctxt "TFRMMAIN.MILINE33.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline37.caption
msgctxt "TFRMMAIN.MILINE37.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline38.caption
msgctxt "TFRMMAIN.MILINE38.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline39.caption
msgctxt "TFRMMAIN.MILINE39.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline4.caption
msgctxt "TFRMMAIN.MILINE4.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline40.caption
msgctxt "TFRMMAIN.MILINE40.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline47.caption
msgctxt "TFRMMAIN.MILINE47.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline5.caption
msgctxt "TFRMMAIN.MILINE5.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline50.caption
msgctxt "TFRMMAIN.MILINE50.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline55.caption
msgctxt "TFRMMAIN.MILINE55.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline6.caption
msgctxt "TFRMMAIN.MILINE6.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline7.caption
msgctxt "TFRMMAIN.MILINE7.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline8.caption
msgctxt "TFRMMAIN.MILINE8.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.miline9.caption
msgctxt "TFRMMAIN.MILINE9.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.milogclear.caption
msgid "Clear"
msgstr ""
#: tfrmmain.milogcopy.caption
msgctxt "TFRMMAIN.MILOGCOPY.CAPTION"
msgid "Copy"
msgstr ""
#: tfrmmain.miloghide.caption
msgid "Hide"
msgstr ""
#: tfrmmain.milogselectall.caption
msgctxt "TFRMMAIN.MILOGSELECTALL.CAPTION"
msgid "Select All"
msgstr ""
#: tfrmmain.mimove.caption
msgid "Move..."
msgstr ""
#: tfrmmain.misymlink.caption
msgid "Create symlink..."
msgstr ""
#: tfrmmain.mitaboptions.caption
msgid "Tab options"
msgstr ""
#: tfrmmain.mitrayiconexit.caption
msgctxt "TFRMMAIN.MITRAYICONEXIT.CAPTION"
msgid "E&xit"
msgstr ""
#: tfrmmain.mitrayiconrestore.caption
msgid "Restore"
msgstr ""
#: tfrmmain.mnualloperpause.caption
msgctxt "tfrmmain.mnualloperpause.caption"
msgid "||"
msgstr ""
#: tfrmmain.mnualloperstart.caption
msgctxt "TFRMMAIN.MNUALLOPERSTART.CAPTION"
msgid "Start"
msgstr ""
#: tfrmmain.mnualloperstop.caption
msgctxt "TFRMMAIN.MNUALLOPERSTOP.CAPTION"
msgid "Cancel"
msgstr ""
#: tfrmmain.mnucmd.caption
msgid "&Commands"
msgstr ""
#: tfrmmain.mnuconfig.caption
msgid "C&onfiguration"
msgstr ""
#: tfrmmain.mnucontextline1.caption
msgctxt "TFRMMAIN.MNUCONTEXTLINE1.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.mnucontextline2.caption
msgctxt "TFRMMAIN.MNUCONTEXTLINE2.CAPTION"
msgid "-"
msgstr ""
#: tfrmmain.mnufavoritetabs.caption
msgid "Favorites"
msgstr ""
#: tfrmmain.mnufiles.caption
msgid "&Files"
msgstr ""
#: tfrmmain.mnuhelp.caption
msgctxt "TFRMMAIN.MNUHELP.CAPTION"
msgid "&Help"
msgstr ""
#: tfrmmain.mnumark.caption
msgid "&Mark"
msgstr ""
#: tfrmmain.mnunetwork.caption
msgctxt "tfrmmain.mnunetwork.caption"
msgid "Network"
msgstr ""
#: tfrmmain.mnushow.caption
msgid "&Show"
msgstr ""
#: tfrmmain.mnutaboptions.caption
msgid "Tab &Options"
msgstr ""
#: tfrmmain.mnutabs.caption
msgid "&Tabs"
msgstr ""
#: tfrmmain.tbchangedir.caption
msgid "CD"
msgstr ""
#: tfrmmain.tbcopy.caption
msgctxt "TFRMMAIN.TBCOPY.CAPTION"
msgid "Copy"
msgstr ""
#: tfrmmain.tbcut.caption
msgctxt "TFRMMAIN.TBCUT.CAPTION"
msgid "Cut"
msgstr ""
#: tfrmmain.tbdelete.caption
msgctxt "TFRMMAIN.TBDELETE.CAPTION"
msgid "Delete"
msgstr ""
#: tfrmmain.tbedit.caption
msgctxt "TFRMMAIN.TBEDIT.CAPTION"
msgid "Edit"
msgstr ""
#: tfrmmain.tbpaste.caption
msgctxt "TFRMMAIN.TBPASTE.CAPTION"
msgid "Paste"
msgstr ""
#: tfrmmain.tbseparator.caption
msgctxt "TFRMMAIN.TBSEPARATOR.CAPTION"
msgid "-"
msgstr ""
#: tfrmmaincommandsdlg.btncancel.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmmaincommandsdlg.btnok.caption
msgctxt "TFRMMAINCOMMANDSDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmmaincommandsdlg.caption
msgid "Select your internal command"
msgstr ""
#: tfrmmaincommandsdlg.cbcategorysortornot.text
msgctxt "tfrmmaincommandsdlg.cbcategorysortornot.text"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbcommandssortornot.text
msgctxt "TFRMMAINCOMMANDSDLG.CBCOMMANDSSORTORNOT.TEXT"
msgid "Legacy sorted"
msgstr ""
#: tfrmmaincommandsdlg.cbselectallcategorydefault.caption
msgid "Select all categories by default"
msgstr ""
#: tfrmmaincommandsdlg.gbselection.caption
msgid "Selection:"
msgstr ""
#: tfrmmaincommandsdlg.lblcategory.caption
msgid "&Categories:"
msgstr ""
#: tfrmmaincommandsdlg.lblcommandname.caption
msgid "Command &name:"
msgstr ""
#: tfrmmaincommandsdlg.lbledtfilter.editlabel.caption
msgid "&Filter:"
msgstr ""
#: tfrmmaincommandsdlg.lblhint.caption
msgid "Hint:"
msgstr ""
#: tfrmmaincommandsdlg.lblhotkey.caption
msgid "Hotkey:"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommand.caption
msgid "cm_name"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandcategory.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandcategory.caption"
msgid "Category"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhelp.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhelp.caption"
msgid "Help"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhint.caption
msgid "Hint"
msgstr ""
#: tfrmmaincommandsdlg.lblselectedcommandhotkey.caption
msgctxt "tfrmmaincommandsdlg.lblselectedcommandhotkey.caption"
msgid "Hotkey"
msgstr ""
#: tfrmmaskinputdlg.btnaddattribute.caption
msgctxt "TFRMMASKINPUTDLG.BTNADDATTRIBUTE.CAPTION"
msgid "&Add"
msgstr ""
#: tfrmmaskinputdlg.btnattrshelp.caption
msgctxt "TFRMMASKINPUTDLG.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr ""
#: tfrmmaskinputdlg.btncancel.caption
msgctxt "TFRMMASKINPUTDLG.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmmaskinputdlg.btndefinetemplate.caption
msgid "&Define..."
msgstr ""
#: tfrmmaskinputdlg.btnok.caption
msgctxt "TFRMMASKINPUTDLG.BTNOK.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmmaskinputdlg.chkcasesensitive.caption
msgid "Case sensitive"
msgstr ""
#: tfrmmaskinputdlg.chkignoreaccentsandligatures.caption
msgid "Ignore accents and ligatures"
msgstr ""
#: tfrmmaskinputdlg.lblattributes.caption
msgid "Attri&butes:"
msgstr ""
#: tfrmmaskinputdlg.lblprompt.caption
msgid "Input Mask:"
msgstr ""
#: tfrmmaskinputdlg.lblsearchtemplate.caption
msgid "O&r select predefined selection type:"
msgstr ""
#: tfrmmkdir.btncancel.caption
msgctxt "TFRMMKDIR.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmmkdir.btnok.caption
msgctxt "TFRMMKDIR.BTNOK.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmmkdir.caption
msgid "Create new directory"
msgstr ""
#: tfrmmkdir.lblmakedir.caption
msgid "&Input new directory name:"
msgstr ""
#: tfrmmodview.btnpath1.caption
msgctxt "TFRMMODVIEW.BTNPATH1.CAPTION"
msgid "..."
msgstr ""
#: tfrmmodview.btnpath2.caption
msgctxt "TFRMMODVIEW.BTNPATH2.CAPTION"
msgid "..."
msgstr ""
#: tfrmmodview.btnpath3.caption
msgctxt "TFRMMODVIEW.BTNPATH3.CAPTION"
msgid "..."
msgstr ""
#: tfrmmodview.btnpath4.caption
msgctxt "TFRMMODVIEW.BTNPATH4.CAPTION"
msgid "..."
msgstr ""
#: tfrmmodview.btnpath5.caption
msgctxt "TFRMMODVIEW.BTNPATH5.CAPTION"
msgid "..."
msgstr ""
#: tfrmmodview.caption
msgctxt "tfrmmodview.caption"
msgid "New Size"
msgstr ""
#: tfrmmodview.lblheight.caption
msgid "Height :"
msgstr ""
#: tfrmmodview.lblpath1.caption
msgctxt "tfrmmodview.lblpath1.caption"
msgid "1"
msgstr ""
#: tfrmmodview.lblpath2.caption
msgid "2"
msgstr ""
#: tfrmmodview.lblpath3.caption
msgid "3"
msgstr ""
#: tfrmmodview.lblpath4.caption
msgid "4"
msgstr ""
#: tfrmmodview.lblpath5.caption
msgid "5"
msgstr ""
#: tfrmmodview.lblquality.caption
msgid "Quality of compress to Jpg"
msgstr ""
#: tfrmmodview.lblwidth.caption
msgid "Width :"
msgstr ""
#: tfrmmodview.rbbmp.caption
msgid "BMP"
msgstr ""
#: tfrmmodview.rbico.caption
msgid "ICO"
msgstr ""
#: tfrmmodview.rbjpg.caption
msgid "JPG"
msgstr ""
#: tfrmmodview.rbpng.caption
msgid "PNG"
msgstr ""
#: tfrmmodview.rbpnm.caption
msgid "PNM"
msgstr ""
#: tfrmmodview.teheight.text
msgctxt "tfrmmodview.teheight.text"
msgid "Height"
msgstr ""
#: tfrmmodview.tequality.text
msgid "80"
msgstr ""
#: tfrmmodview.tewidth.text
msgctxt "tfrmmodview.tewidth.text"
msgid "Width"
msgstr ""
#: tfrmmsg.lblmsg.caption
msgid "456456465465465"
msgstr ""
#: tfrmmultirename.btnclose.caption
msgctxt "TFRMMULTIRENAME.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr ""
#: tfrmmultirename.btndeletepreset.caption
msgctxt "TFRMMULTIRENAME.BTNDELETEPRESET.CAPTION"
msgid "&Delete"
msgstr ""
#: tfrmmultirename.btnedit.caption
msgctxt "TFRMMULTIRENAME.BTNEDIT.CAPTION"
msgid "&Edit"
msgstr ""
#: tfrmmultirename.btnextmenu.caption
msgctxt "TFRMMULTIRENAME.BTNEXTMENU.CAPTION"
msgid "..."
msgstr ""
#: tfrmmultirename.btnloadpreset.caption
msgid "&Load"
msgstr ""
#: tfrmmultirename.btnnamemenu.caption
msgctxt "TFRMMULTIRENAME.BTNNAMEMENU.CAPTION"
msgid "..."
msgstr ""
#: tfrmmultirename.btnrename.caption
msgctxt "tfrmmultirename.btnrename.caption"
msgid "&Rename"
msgstr ""
#: tfrmmultirename.btnrestore.caption
msgid "Reset &all"
msgstr ""
#: tfrmmultirename.btnsavepreset.caption
msgctxt "TFRMMULTIRENAME.BTNSAVEPRESET.CAPTION"
msgid "&Save"
msgstr ""
#: tfrmmultirename.caption
msgid "MultiRename"
msgstr ""
#: tfrmmultirename.cblog.caption
msgid "Ena&ble"
msgstr ""
#: tfrmmultirename.cbregexp.caption
msgid "Regular e&xpressions"
msgstr ""
#: tfrmmultirename.cbusesubs.caption
msgid "&Use substitution"
msgstr ""
#: tfrmmultirename.cmbxwidth.text
msgid "01"
msgstr ""
#: tfrmmultirename.edinterval.text
msgctxt "TFRMMULTIRENAME.EDINTERVAL.TEXT"
msgid "1"
msgstr ""
#: tfrmmultirename.edpoc.text
msgctxt "TFRMMULTIRENAME.EDPOC.TEXT"
msgid "1"
msgstr ""
#: tfrmmultirename.extension.caption
msgid "[E] Extension"
msgstr ""
#: tfrmmultirename.gbcounter.caption
msgid "Counter"
msgstr ""
#: tfrmmultirename.gbfindreplace.caption
msgid "Find && Replace"
msgstr ""
#: tfrmmultirename.gblog.caption
msgid "Log Result"
msgstr ""
#: tfrmmultirename.gbmaska.caption
msgid "Mask"
msgstr ""
#: tfrmmultirename.gbpresets.caption
msgid "Presets"
msgstr ""
#: tfrmmultirename.lbext.caption
msgid "&Extension"
msgstr ""
#: tfrmmultirename.lbfind.caption
msgid "&Find..."
msgstr ""
#: tfrmmultirename.lbinterval.caption
msgid "&Interval"
msgstr ""
#: tfrmmultirename.lbname.caption
msgid "File &Name"
msgstr ""
#: tfrmmultirename.lbreplace.caption
msgid "Re&place..."
msgstr ""
#: tfrmmultirename.lbstnb.caption
msgid "S&tart Number"
msgstr ""
#: tfrmmultirename.lbwidth.caption
msgid "&Width"
msgstr ""
#: tfrmmultirename.micounter.caption
msgid "[C] Counter"
msgstr ""
#: tfrmmultirename.miday.caption
msgid "[D] Day"
msgstr ""
#: tfrmmultirename.miday1.caption
msgid "[DD] Day (2 digits)"
msgstr ""
#: tfrmmultirename.miday2.caption
msgid "[DDD] Day of the week (short, e.g., \"mon\")"
msgstr ""
#: tfrmmultirename.miday3.caption
msgid "[DDDD] Day of the week (long, e.g., \"monday\")"
msgstr ""
#: tfrmmultirename.miextensionx.caption
msgid "[Ex] Character at position x"
msgstr ""
#: tfrmmultirename.miextensionxx.caption
msgid "[Ex:y] Characters from position x to y"
msgstr ""
#: tfrmmultirename.mihour.caption
msgid "[h] Hour"
msgstr ""
#: tfrmmultirename.mihour1.caption
msgid "[hh] Hour (2 digits)"
msgstr ""
#: tfrmmultirename.miminute.caption
msgid "[n] Minute"
msgstr ""
#: tfrmmultirename.miminute1.caption
msgid "[nn] Minute (2 digits)"
msgstr ""
#: tfrmmultirename.mimonth.caption
msgid "[M] Month"
msgstr ""
#: tfrmmultirename.mimonth1.caption
msgid "[MM] Month (2 digits)"
msgstr ""
#: tfrmmultirename.mimonth2.caption
msgid "[MMM] Month name (short, e.g., \"jan\")"
msgstr ""
#: tfrmmultirename.mimonth3.caption
msgid "[MMMM] Month name (long, e.g., \"january\")"
msgstr ""
#: tfrmmultirename.miname.caption
msgid "[N] Name"
msgstr ""
#: tfrmmultirename.minamex.caption
msgid "[Nx] Character at position x"
msgstr ""
#: tfrmmultirename.minamexx.caption
msgid "[Nx:y] Characters from position x to y"
msgstr ""
#: tfrmmultirename.minext.caption
msgid "Time..."
msgstr ""
#: tfrmmultirename.minextextension.caption
msgid "Extension..."
msgstr ""
#: tfrmmultirename.minextname.caption
msgid "Name..."
msgstr ""
#: tfrmmultirename.miplugin.caption
msgctxt "tfrmmultirename.miplugin.caption"
msgid "Plugin"
msgstr ""
#: tfrmmultirename.misecond.caption
msgid "[s] Second"
msgstr ""
#: tfrmmultirename.misecond1.caption
msgid "[ss] Second (2 digits)"
msgstr ""
#: tfrmmultirename.miyear.caption
msgid "[Y] Year (2 digits)"
msgstr ""
#: tfrmmultirename.miyear1.caption
msgid "[YYYY] Year (4 digits)"
msgstr ""
#: tfrmmultirename.mnueditnames.caption
msgid "Edit names..."
msgstr ""
#: tfrmmultirename.mnuloadfromfile.caption
msgid "Load names from file..."
msgstr ""
#: tfrmmultirename.n1.caption
msgctxt "TFRMMULTIRENAME.N1.CAPTION"
msgid "-"
msgstr ""
#: tfrmmultirename.n2.caption
msgctxt "TFRMMULTIRENAME.N2.CAPTION"
msgid "-"
msgstr ""
#: tfrmmultirename.n3.caption
msgctxt "TFRMMULTIRENAME.N3.CAPTION"
msgid "-"
msgstr ""
#: tfrmmultirename.n4.caption
msgctxt "TFRMMULTIRENAME.N4.CAPTION"
msgid "-"
msgstr ""
#: tfrmmultirename.n5.caption
msgctxt "TFRMMULTIRENAME.N5.CAPTION"
msgid "-"
msgstr ""
#: tfrmmultirename.stringgrid.columns[0].title.caption
msgid "Old File Name"
msgstr ""
#: tfrmmultirename.stringgrid.columns[1].title.caption
msgid "New File Name"
msgstr ""
#: tfrmmultirename.stringgrid.columns[2].title.caption
msgid "File Path"
msgstr ""
#: tfrmmultirenamewait.caption
msgctxt "TFRMMULTIRENAMEWAIT.CAPTION"
msgid "Double Commander"
msgstr ""
#: tfrmmultirenamewait.lblmessage.caption
msgid "Click OK when you have closed the editor to load the changed names!"
msgstr ""
#: tfrmopenwith.caption
msgid "Choose an application"
msgstr ""
#: tfrmopenwith.chkcustomcommand.caption
msgid "Custom command"
msgstr ""
#: tfrmopenwith.chksaveassociation.caption
msgid "Save association"
msgstr ""
#: tfrmopenwith.chkuseasdefault.caption
msgid "Set selected application as default action"
msgstr ""
#: tfrmopenwith.lblmimetype.caption
msgid "File type to be opened: %s"
msgstr ""
#: tfrmopenwith.milistoffiles.caption
msgid "Multiple file names"
msgstr ""
#: tfrmopenwith.milistoffiles.hint
msgid "%F"
msgstr ""
#: tfrmopenwith.milistofurls.caption
msgid "Multiple URIs"
msgstr ""
#: tfrmopenwith.milistofurls.hint
msgid "%U"
msgstr ""
#: tfrmopenwith.misinglefilename.caption
msgid "Single file name"
msgstr ""
#: tfrmopenwith.misinglefilename.hint
msgid "%f"
msgstr ""
#: tfrmopenwith.misingleurl.caption
msgid "Single URI"
msgstr ""
#: tfrmopenwith.misingleurl.hint
msgid "%u"
msgstr ""
#: tfrmoptions.btnapply.caption
msgid "&Apply"
msgstr ""
#: tfrmoptions.btncancel.caption
msgctxt "TFRMOPTIONS.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmoptions.btnok.caption
msgctxt "TFRMOPTIONS.BTNOK.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmoptions.caption
msgctxt "tfrmoptions.caption"
msgid "Options"
msgstr ""
#: tfrmoptions.lblemptyeditor.caption
msgid "Please select one of the subpages, this page does not contain any settings."
msgstr ""
#: tfrmoptionsarchivers.btnautoconfig.caption
msgid "A&uto Configure"
msgstr ""
#: tfrmoptionsarchivers.btnmultiarcadd.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCADD.CAPTION"
msgid "A&dd"
msgstr ""
#: tfrmoptionsarchivers.btnmultiarcapply.caption
msgctxt "tfrmoptionsarchivers.btnmultiarcapply.caption"
msgid "A&pply"
msgstr ""
#: tfrmoptionsarchivers.btnmultiarcdelete.caption
msgctxt "tfrmoptionsarchivers.btnmultiarcdelete.caption"
msgid "D&elete"
msgstr ""
#: tfrmoptionsarchivers.btnmultiarcrename.caption
msgctxt "TFRMOPTIONSARCHIVERS.BTNMULTIARCRENAME.CAPTION"
msgid "&Rename"
msgstr ""
#: tfrmoptionsarchivers.btnrelativearchiver.hint
msgctxt "tfrmoptionsarchivers.btnrelativearchiver.hint"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsarchivers.chkmultiarcdebug.caption
msgid "De&bug mode"
msgstr ""
#: tfrmoptionsarchivers.chkmultiarcenabled.caption
msgid "E&nabled"
msgstr ""
#: tfrmoptionsarchivers.chkmultiarcoutput.caption
msgid "S&how console output"
msgstr ""
#: tfrmoptionsarchivers.gbarchiveroptions.caption
msgctxt "TFRMOPTIONSARCHIVERS.GBARCHIVEROPTIONS.CAPTION"
msgid "Options"
msgstr ""
#: tfrmoptionsarchivers.lblarchiveadd.caption
msgid "Add&ing:"
msgstr ""
#: tfrmoptionsarchivers.lblarchiveextension.caption
msgid "E&xtension:"
msgstr ""
#: tfrmoptionsarchivers.lblarchiveextract.caption
msgid "Ex&tract:"
msgstr ""
#: tfrmoptionsarchivers.lblarchivelist.caption
msgid "&List:"
msgstr ""
#: tfrmoptionsarchivers.lblarchivelistend.caption
msgid "Listing &finish (optional):"
msgstr ""
#: tfrmoptionsarchivers.lblarchivelistformat.caption
msgid "Listing for&mat:"
msgstr ""
#: tfrmoptionsarchivers.lblarchiveliststart.caption
msgid "Listin&g start (optional):"
msgstr ""
#: tfrmoptionsarchivers.lblarchiver.caption
msgid "Arc&hiver:"
msgstr ""
#: tfrmoptionsarchivers.lbldescription.caption
msgid "De&scription:"
msgstr ""
#: tfrmoptionsarchivers.tbarchiveradditional.caption
msgid "Additional"
msgstr ""
#: tfrmoptionsarchivers.tbarchivergeneral.caption
msgctxt "tfrmoptionsarchivers.tbarchivergeneral.caption"
msgid "General"
msgstr ""
#: tfrmoptionsautorefresh.cbwatchattributeschange.caption
msgid "When &size, date or attributes change"
msgstr ""
#: tfrmoptionsautorefresh.cbwatchexcludedirs.caption
msgctxt "tfrmoptionsautorefresh.cbwatchexcludedirs.caption"
msgid "For the following &paths and their subdirectories:"
msgstr ""
#: tfrmoptionsautorefresh.cbwatchfilenamechange.caption
msgid "When &files are created, deleted or renamed"
msgstr ""
#: tfrmoptionsautorefresh.cbwatchonlyforeground.caption
msgid "When application is in the &background"
msgstr ""
#: tfrmoptionsautorefresh.gbautorefreshdisable.caption
msgid "Disable auto-refresh"
msgstr ""
#: tfrmoptionsautorefresh.gbautorefreshenable.caption
msgid "Refresh file list"
msgstr ""
#: tfrmoptionsbehavior.cbalwaysshowtrayicon.caption
msgid "Al&ways show tray icon"
msgstr ""
#: tfrmoptionsbehavior.cbblacklistunmounteddevices.caption
msgid "Automatically &hide unmounted devices"
msgstr ""
#: tfrmoptionsbehavior.cbminimizetotray.caption
msgid "Mo&ve icon to system tray when minimized"
msgstr ""
#: tfrmoptionsbehavior.cbonlyonce.caption
msgid "A&llow only one copy of DC at a time"
msgstr ""
#: tfrmoptionsbehavior.edtdrivesblacklist.hint
msgid "Here you can enter one or more drives or mount points, separated by \";\"."
msgstr ""
#: tfrmoptionsbehavior.lbldrivesblacklist.caption
msgid "Drives &blacklist"
msgstr ""
#: tfrmoptionsbriefview.gbcolumns.caption
msgid "Columns size"
msgstr ""
#: tfrmoptionsbriefview.gbshowfileext.caption
msgid "Show file extensions"
msgstr ""
#: tfrmoptionsbriefview.rbaligned.caption
msgid "ali&gned (with Tab)"
msgstr ""
#: tfrmoptionsbriefview.rbdirectly.caption
msgid "di&rectly after filename"
msgstr ""
#: tfrmoptionsbriefview.rbuseautosize.caption
msgid "Auto"
msgstr ""
#: tfrmoptionsbriefview.rbusefixedcount.caption
msgid "Fixed columns count"
msgstr ""
#: tfrmoptionsbriefview.rbusefixedwidth.caption
msgid "Fixed columns width"
msgstr ""
#: tfrmoptionscolumnsview.cbcuttexttocolwidth.caption
msgid "Cut &text to column width"
msgstr ""
#: tfrmoptionscolumnsview.cbgridhorzline.caption
msgid "&Horizontal lines"
msgstr ""
#: tfrmoptionscolumnsview.cbgridvertline.caption
msgid "&Vertical lines"
msgstr ""
#: tfrmoptionscolumnsview.chkautofillcolumns.caption
msgid "A&uto fill columns"
msgstr ""
#: tfrmoptionscolumnsview.gbshowgrid.caption
msgid "Show grid"
msgstr ""
#: tfrmoptionscolumnsview.grpautosizecolumns.caption
msgid "Auto-size columns"
msgstr ""
#: tfrmoptionscolumnsview.lblautosizecolumn.caption
msgid "Auto si&ze column:"
msgstr ""
#: tfrmoptionsconfiguration.btnconfigapply.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGAPPLY.CAPTION"
msgid "A&pply"
msgstr ""
#: tfrmoptionsconfiguration.btnconfigedit.caption
msgctxt "TFRMOPTIONSCONFIGURATION.BTNCONFIGEDIT.CAPTION"
msgid "&Edit"
msgstr ""
#: tfrmoptionsconfiguration.cbcmdlinehistory.caption
msgid "Co&mmand line history"
msgstr ""
#: tfrmoptionsconfiguration.cbdirhistory.caption
msgid "&Directory history"
msgstr ""
#: tfrmoptionsconfiguration.cbfilemaskhistory.caption
msgid "&File mask history"
msgstr ""
#: tfrmoptionsconfiguration.chksaveconfiguration.caption
msgid "Sa&ve configuration"
msgstr ""
#: tfrmoptionsconfiguration.chksearchreplacehistory.caption
msgid "Searc&h/Replace history"
msgstr ""
#: tfrmoptionsconfiguration.gblocconfigfiles.caption
msgid "Location of configuration files"
msgstr ""
#: tfrmoptionsconfiguration.gbsaveonexit.caption
msgid "Save on exit"
msgstr ""
#: tfrmoptionsconfiguration.gbsortorderconfigurationoption.caption
msgid "Sort order of configuration order in left tree"
msgstr ""
#: tfrmoptionsconfiguration.lblcmdlineconfigdir.caption
msgid "Set on command line"
msgstr ""
#: tfrmoptionsconfiguration.rbprogramdir.caption
msgid "P&rogram directory (portable version)"
msgstr ""
#: tfrmoptionsconfiguration.rbuserhomedir.caption
msgid "&User home directory"
msgstr ""
#: tfrmoptionscustomcolumns.btnallallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.CAPTION"
msgid "All"
msgstr ""
#: tfrmoptionscustomcolumns.btnallallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLALLOWOVERCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.CAPTION"
msgid "All"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.CAPTION"
msgid "All"
msgstr ""
#: tfrmoptionscustomcolumns.btnallbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLBACKCOLOR2.HINT"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.CAPTION"
msgid "All"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.CAPTION"
msgid "All"
msgstr ""
#: tfrmoptionscustomcolumns.btnallcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLCURSORTEXT.HINT"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallfont.caption
msgctxt "tfrmoptionscustomcolumns.btnallfont.caption"
msgid "All"
msgstr ""
#: tfrmoptionscustomcolumns.btnallfont.hint
msgctxt "tfrmoptionscustomcolumns.btnallfont.hint"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.CAPTION"
msgid "All"
msgstr ""
#: tfrmoptionscustomcolumns.btnallforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLFORECOLOR.HINT"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.CAPTION"
msgid "All"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVECURSORCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.CAPTION"
msgid "All"
msgstr ""
#: tfrmoptionscustomcolumns.btnallinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLINACTIVEMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnallmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.CAPTION"
msgid "All"
msgstr ""
#: tfrmoptionscustomcolumns.btnallmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLMARKCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.CAPTION"
msgid "All"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINACTIVESELCOLOR.HINT"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.CAPTION"
msgid "All"
msgstr ""
#: tfrmoptionscustomcolumns.btnalluseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNALLUSEINVERTEDSELECTION.HINT"
msgid "Apply modification to all columns"
msgstr ""
#: tfrmoptionscustomcolumns.btnbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionscustomcolumns.btnbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionscustomcolumns.btncursorbordercolor.caption
msgctxt "tfrmoptionscustomcolumns.btncursorbordercolor.caption"
msgid ">>"
msgstr ""
#: tfrmoptionscustomcolumns.btncursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionscustomcolumns.btncursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionscustomcolumns.btndeleteconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNDELETECONFIGCOLUMNS.CAPTION"
msgid "&Delete"
msgstr ""
#: tfrmoptionscustomcolumns.btnfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFONT.CAPTION"
msgid "..."
msgstr ""
#: tfrmoptionscustomcolumns.btnforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionscustomcolumns.btngotosetdefault.caption
msgid "Go to set default"
msgstr ""
#: tfrmoptionscustomcolumns.btngotosetdefault.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNGOTOSETDEFAULT.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionscustomcolumns.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionscustomcolumns.btnmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionscustomcolumns.btnnewconfig.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNNEWCONFIG.CAPTION"
msgid "New"
msgstr ""
#: tfrmoptionscustomcolumns.btnnext.caption
msgid "Next"
msgstr ""
#: tfrmoptionscustomcolumns.btnprev.caption
msgid "Previous"
msgstr ""
#: tfrmoptionscustomcolumns.btnrenameconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRENAMECONFIGCOLUMNS.CAPTION"
msgid "Rename"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetallowovercolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetallowovercolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETALLOWOVERCOLOR.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor2.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetbackcolor2.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETBACKCOLOR2.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.caption"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorborder.hint
msgctxt "tfrmoptionscustomcolumns.btnresetcursorborder.hint"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORCOLOR.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursortext.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetcursortext.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETCURSORTEXT.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetfont.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetfont.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFONT.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetforecolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetforecolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFORECOLOR.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetframecursor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetframecursor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETFRAMECURSOR.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivecursorcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVECURSORCOLOR.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetinactivemarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETINACTIVEMARKCOLOR.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetmarkcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetmarkcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETMARKCOLOR.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinactiveselcolor.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINACTIVESELCOLOR.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.CAPTION"
msgid "R"
msgstr ""
#: tfrmoptionscustomcolumns.btnresetuseinvertedselection.hint
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNRESETUSEINVERTEDSELECTION.HINT"
msgid "Reset to default"
msgstr ""
#: tfrmoptionscustomcolumns.btnsaveasconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVEASCONFIGCOLUMNS.CAPTION"
msgid "Save as"
msgstr ""
#: tfrmoptionscustomcolumns.btnsaveconfigcolumns.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.BTNSAVECONFIGCOLUMNS.CAPTION"
msgid "Save"
msgstr ""
#: tfrmoptionscustomcolumns.cballowovercolor.caption
msgctxt "tfrmoptionscustomcolumns.cballowovercolor.caption"
msgid "Allow Overcolor"
msgstr ""
#: tfrmoptionscustomcolumns.cbapplychangeforallcolumns.caption
msgid "When clicking to change something, change for all columns"
msgstr ""
#: tfrmoptionscustomcolumns.cbconfigcolumns.text
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.CBCONFIGCOLUMNS.TEXT"
msgid "General"
msgstr ""
#: tfrmoptionscustomcolumns.cbcursorborder.caption
msgctxt "tfrmoptionscustomcolumns.cbcursorborder.caption"
msgid "Cursor border"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseframecursor.caption
msgid "Use Frame Cursor"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseinactiveselcolor.caption
msgid "Use Inactive Selection Color"
msgstr ""
#: tfrmoptionscustomcolumns.cbuseinvertedselection.caption
msgid "Use Inverted Selection"
msgstr ""
#: tfrmoptionscustomcolumns.chkusecustomview.caption
msgid "Use custom font and color for this view"
msgstr ""
#: tfrmoptionscustomcolumns.lblbackcolor.caption
msgid "BackGround:"
msgstr ""
#: tfrmoptionscustomcolumns.lblbackcolor2.caption
msgid "Background 2:"
msgstr ""
#: tfrmoptionscustomcolumns.lblconfigcolumns.caption
msgid "Con&figure columns view:"
msgstr ""
#: tfrmoptionscustomcolumns.lblcurrentcolumn.caption
msgid "[Current Column Name]"
msgstr ""
#: tfrmoptionscustomcolumns.lblcursorcolor.caption
msgid "Cursor Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblcursortext.caption
msgid "Cursor Text:"
msgstr ""
#: tfrmoptionscustomcolumns.lblfontname.caption
msgid "Font:"
msgstr ""
#: tfrmoptionscustomcolumns.lblfontsize.caption
msgctxt "TFRMOPTIONSCUSTOMCOLUMNS.LBLFONTSIZE.CAPTION"
msgid "Size:"
msgstr ""
#: tfrmoptionscustomcolumns.lblforecolor.caption
msgid "Text Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblinactivecursorcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivecursorcolor.caption"
msgid "Inactive Cursor Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblinactivemarkcolor.caption
msgctxt "tfrmoptionscustomcolumns.lblinactivemarkcolor.caption"
msgid "Inactive Mark Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblmarkcolor.caption
msgid "Mark Color:"
msgstr ""
#: tfrmoptionscustomcolumns.lblpreviewtop.caption
msgctxt "tfrmoptionscustomcolumns.lblpreviewtop.caption"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionscustomcolumns.lblworkingcolumn.caption
msgid "Settings for column:"
msgstr ""
#: tfrmoptionscustomcolumns.miaddcolumn.caption
msgid "Add column"
msgstr ""
#: tfrmoptionsdiffer.rgresultingframepositionaftercompare.caption
msgid "Position of frame panel after the comparison:"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnadd.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnadd.caption"
msgid "Add..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnbackup.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnbackup.caption"
msgid "Backup..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btndelete.caption
msgctxt "tfrmoptionsdirectoryhotlist.btndelete.caption"
msgid "Delete..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnexport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnexport.caption"
msgid "Export..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnhelp.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNHELP.CAPTION"
msgid "Help"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnimport.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnimport.caption"
msgid "Import..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btninsert.caption
msgctxt "tfrmoptionsdirectoryhotlist.btninsert.caption"
msgid "Insert..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnmiscellaneous.caption
msgid "Miscellaneous..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnrelativepath.hint
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.BTNRELATIVEPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnrelativetarget.hint
msgid "Some functions to select appropriate target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.btnsort.caption
msgctxt "tfrmoptionsdirectoryhotlist.btnsort.caption"
msgid "Sort..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbaddtarget.caption
msgid "When adding directory, add also target"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption
msgctxt "tfrmoptionsdirectoryhotlist.cbfullexpandtree.caption"
msgid "Always expand tree"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbshowonlyvalidenv.caption
msgid "Show only valid environment variables"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbshowpathinpopup.caption
msgid "In popup, show [path also]"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text
msgctxt "tfrmoptionsdirectoryhotlist.cbsorthotdirpath.text"
msgid "Name, a-z"
msgstr ""
#: tfrmoptionsdirectoryhotlist.cbsorthotdirtarget.text
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.CBSORTHOTDIRTARGET.TEXT"
msgid "Name, a-z"
msgstr ""
#: tfrmoptionsdirectoryhotlist.gbdirectoryhotlist.caption
msgid "Directory Hotlist (reorder by drag && drop)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption
msgctxt "tfrmoptionsdirectoryhotlist.gbhotlistotheroptions.caption"
msgid "Other options"
msgstr ""
#: tfrmoptionsdirectoryhotlist.lbledithotdirname.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRNAME.EDITLABEL.CAPTION"
msgid "Name:"
msgstr ""
#: tfrmoptionsdirectoryhotlist.lbledithotdirpath.editlabel.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.LBLEDITHOTDIRPATH.EDITLABEL.CAPTION"
msgid "Path:"
msgstr ""
#: tfrmoptionsdirectoryhotlist.lbledithotdirtarget.editlabel.caption
msgid "Target:"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miactiveframedirectory.caption
msgid "directory of the active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miactiveinactiveframedirectory.caption
msgid "directories of the active && inactive frames"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddcommand.caption
msgid "a command"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddcommand2.caption
msgid "Add a command"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddcopyofselected.caption
msgid "a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddcopyofselected2.caption
msgid "Add a copy of the selected entry"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddseparator.caption
msgctxt "tfrmoptionsdirectoryhotlist.miaddseparator.caption"
msgid "a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddseparator2.caption
msgid "Add a separator"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddsubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.miaddsubmenu.caption"
msgid "sub-menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miaddsubmenu2.caption
msgctxt "tfrmoptionsdirectoryhotlist.miaddsubmenu2.caption"
msgid "Add sub-menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mibrowsetodirectory.caption
msgid "directory I will browse to"
msgstr ""
#: tfrmoptionsdirectoryhotlist.micollapseall.caption
msgctxt "tfrmoptionsdirectoryhotlist.micollapseall.caption"
msgid "Collapse all"
msgstr ""
#: tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption
msgctxt "tfrmoptionsdirectoryhotlist.micurrentlevelofitemonly.caption"
msgid "...current level of item(s) selected only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.micurrentselectedoractivedirectories.caption
msgid "current selected or active directories of active frame"
msgstr ""
#: tfrmoptionsdirectoryhotlist.micutselection.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MICUTSELECTION.CAPTION"
msgid "Cut"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mideleteallhotdirs.caption
msgctxt "tfrmoptionsdirectoryhotlist.mideleteallhotdirs.caption"
msgid "delete all!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mideletecompletesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mideletecompletesubmenu.caption"
msgid "sub-menu and all its elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mideletejustsubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mideletejustsubmenu.caption"
msgid "just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mideleteselectedentry.caption
msgctxt "tfrmoptionsdirectoryhotlist.mideleteselectedentry.caption"
msgid "selected item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mideleteselectedentry2.caption
msgctxt "tfrmoptionsdirectoryhotlist.mideleteselectedentry2.caption"
msgid "Delete selected item"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathexist.caption
msgid "Scan all hotdir's path to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.midetectifpathtargetexist.caption
msgid "Scan all hotdir's path && target to validate the ones that actually exist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttohotlistfile.caption
msgid "to a Directory Hotlist file (.hotlist)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommanderk.caption"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption
msgctxt "tfrmoptionsdirectoryhotlist.miexporttototalcommandernk.caption"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption
msgctxt "tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo1.caption"
msgid "Go to configure TC related info"
msgstr ""
#: tfrmoptionsdirectoryhotlist.migotoconfiguretcinfo2.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIGOTOCONFIGURETCINFO2.CAPTION"
msgid "Go to configure TC related info"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mihotdirtestmenu.caption
msgid "HotDirTestMenu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miimportfromhotlistfile.caption
msgid "from a Directory Hotlist file (.hotlist)"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miimporttotalcommander.caption
msgid "from \"wincmd.ini\" of TC"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miopenallbranches.caption
msgctxt "tfrmoptionsdirectoryhotlist.miopenallbranches.caption"
msgid "Open all branches"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mipasteselection.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MIPASTESELECTION.CAPTION"
msgid "Paste"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mirestorebackuphotlist.caption
msgid "Restore a backup of Directory Hotlist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misavebackuphotlist.caption
msgid "Save a backup of current Directory Hotlist"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misearchandreplace.caption
msgctxt "tfrmoptionsdirectoryhotlist.misearchandreplace.caption"
msgid "Search and replace..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.misearchandreplaceinpath.caption
msgid "in path..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.misearchandreplaceintargetpath.caption
msgid "in target path..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.misearchinreplaceinbothpaths.caption
msgid "in path and target path..."
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator1.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR1.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator10.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR10.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator11.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR11.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator12.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR12.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator13.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR13.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator2.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR2.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator3.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR3.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator4.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR4.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator5.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR5.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator6.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR6.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator7.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR7.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator8.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR8.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.miseparator9.caption
msgctxt "TFRMOPTIONSDIRECTORYHOTLIST.MISEPARATOR9.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misorteverything.caption
msgctxt "tfrmoptionsdirectoryhotlist.misorteverything.caption"
msgid "...everything, from A to Z!"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglegroup.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup.caption"
msgid "...single group of item(s) only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglegroup2.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglegroup2.caption"
msgid "Sort single group of item(s) only"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsinglesubmenu.caption"
msgid "...content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption
msgctxt "tfrmoptionsdirectoryhotlist.misortsubmenuandsublevel.caption"
msgid "...content of submenu(s) selected and all sublevels"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption
msgctxt "tfrmoptionsdirectoryhotlist.mitestresultinghotlistmenu.caption"
msgid "Test resulting menu"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitypethedirectory.caption
msgid "directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitypethedirectory2.caption
msgid "Add directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.mitypethedirectory3.caption
msgid "Insert directory I will type"
msgstr ""
#: tfrmoptionsdirectoryhotlist.rgwheretoadd.caption
msgid "Addition from main panel:"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropaskformateachtime.caption
msgid "From all the supported formats, ask which one to use every time"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddropsaveunicodetextinuft8.caption
msgid "When saving Unicode text, save it in UTF8 format (will be UTF16 otherwise)"
msgstr ""
#: tfrmoptionsdragdrop.cbdraganddroptextautofilename.caption
msgid "When dropping text, generate filename automatically (otherwise will prompt the user)"
msgstr ""
#: tfrmoptionsdragdrop.cbshowconfirmationdialog.caption
msgid "&Show confirmation dialog after drop"
msgstr ""
#: tfrmoptionsdragdrop.gbtextdraganddroprelatedoptions.caption
msgid "When drag && dropping text into panels:"
msgstr ""
#: tfrmoptionsdragdrop.lblmostdesiredtextformat1.caption
msgid "Place the most desired format on top of list (use dag && drop):"
msgstr ""
#: tfrmoptionsdragdrop.lblmostdesiredtextformat2.caption
msgid "(if the most desired is not present, we'll take second one and so on)"
msgstr ""
#: tfrmoptionsdragdrop.lblwarningforaskformat.caption
msgid "(will not work with some source application, so try to uncheck if problem)"
msgstr ""
#: tfrmoptionsdriveslistbutton.cbshowfilesystem.caption
msgid "Show &file system"
msgstr ""
#: tfrmoptionsdriveslistbutton.cbshowfreespace.caption
msgid "Show fr&ee space"
msgstr ""
#: tfrmoptionsdriveslistbutton.cbshowlabel.caption
msgid "Show &label"
msgstr ""
#: tfrmoptionsdriveslistbutton.gbdriveslist.caption
msgid "Drives list"
msgstr ""
#: tfrmoptionseditor.chkscrollpastendline.caption
msgid "Caret past end of line"
msgstr ""
#: tfrmoptionseditor.chkshowspecialchars.caption
msgid "Show special characters"
msgstr ""
#: tfrmoptionseditor.gbinternaleditor.caption
msgid "Internal editor options"
msgstr ""
#: tfrmoptionseditorcolors.backgroundlabel.caption
msgctxt "tfrmoptionseditorcolors.backgroundlabel.caption"
msgid "Bac&kground"
msgstr ""
#: tfrmoptionseditorcolors.backgroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.BACKGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Bac&kground"
msgstr ""
#: tfrmoptionseditorcolors.btnresetmask.hint
msgid "Reset"
msgstr ""
#: tfrmoptionseditorcolors.btnsavemask.hint
msgctxt "TFRMOPTIONSEDITORCOLORS.BTNSAVEMASK.HINT"
msgid "Save"
msgstr ""
#: tfrmoptionseditorcolors.bvlattributesection.caption
msgid "Element Attributes"
msgstr ""
#: tfrmoptionseditorcolors.foregroundlabel.caption
msgctxt "tfrmoptionseditorcolors.foregroundlabel.caption"
msgid "Fo&reground"
msgstr ""
#: tfrmoptionseditorcolors.foregroundusedefaultcheckbox.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.FOREGROUNDUSEDEFAULTCHECKBOX.CAPTION"
msgid "Fo&reground"
msgstr ""
#: tfrmoptionseditorcolors.framecolorusedefaultcheckbox.caption
msgid "&Text-mark"
msgstr ""
#: tfrmoptionseditorcolors.tbtnglobal.caption
msgid "Use (and edit) &global scheme settings"
msgstr ""
#: tfrmoptionseditorcolors.tbtnlocal.caption
msgid "Use &local scheme settings"
msgstr ""
#: tfrmoptionseditorcolors.textboldcheckbox.caption
msgid "&Bold"
msgstr ""
#: tfrmoptionseditorcolors.textboldradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr ""
#: tfrmoptionseditorcolors.textboldradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOOFF.CAPTION"
msgid "O&ff"
msgstr ""
#: tfrmoptionseditorcolors.textboldradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTBOLDRADIOON.CAPTION"
msgid "O&n"
msgstr ""
#: tfrmoptionseditorcolors.textitaliccheckbox.caption
msgid "&Italic"
msgstr ""
#: tfrmoptionseditorcolors.textitalicradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr ""
#: tfrmoptionseditorcolors.textitalicradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOOFF.CAPTION"
msgid "O&ff"
msgstr ""
#: tfrmoptionseditorcolors.textitalicradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTITALICRADIOON.CAPTION"
msgid "O&n"
msgstr ""
#: tfrmoptionseditorcolors.textstrikeoutcheckbox.caption
msgid "&Strike Out"
msgstr ""
#: tfrmoptionseditorcolors.textstrikeoutradioinvert.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOINVERT.CAPTION"
msgid "In&vert"
msgstr ""
#: tfrmoptionseditorcolors.textstrikeoutradiooff.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOOFF.CAPTION"
msgid "O&ff"
msgstr ""
#: tfrmoptionseditorcolors.textstrikeoutradioon.caption
msgctxt "TFRMOPTIONSEDITORCOLORS.TEXTSTRIKEOUTRADIOON.CAPTION"
msgid "O&n"
msgstr ""
#: tfrmoptionseditorcolors.textunderlinecheckbox.caption
msgid "&Underline"
msgstr ""
#: tfrmoptionseditorcolors.textunderlineradioinvert.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioinvert.caption"
msgid "In&vert"
msgstr ""
#: tfrmoptionseditorcolors.textunderlineradiooff.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradiooff.caption"
msgid "O&ff"
msgstr ""
#: tfrmoptionseditorcolors.textunderlineradioon.caption
msgctxt "tfrmoptionseditorcolors.textunderlineradioon.caption"
msgid "O&n"
msgstr ""
#: tfrmoptionsfavoritetabs.btnadd.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNADD.CAPTION"
msgid "Add..."
msgstr ""
#: tfrmoptionsfavoritetabs.btndelete.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNDELETE.CAPTION"
msgid "Delete..."
msgstr ""
#: tfrmoptionsfavoritetabs.btnimportexport.caption
msgid "Import/Export"
msgstr ""
#: tfrmoptionsfavoritetabs.btninsert.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNINSERT.CAPTION"
msgid "Insert..."
msgstr ""
#: tfrmoptionsfavoritetabs.btnrename.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNRENAME.CAPTION"
msgid "Rename"
msgstr ""
#: tfrmoptionsfavoritetabs.btnsort.caption
msgctxt "TFRMOPTIONSFAVORITETABS.BTNSORT.CAPTION"
msgid "Sort..."
msgstr ""
#: tfrmoptionsfavoritetabs.cbexistingtabstokeep.text
msgctxt "tfrmoptionsfavoritetabs.cbexistingtabstokeep.text"
msgid "None"
msgstr ""
#: tfrmoptionsfavoritetabs.cbfullexpandtree.caption
msgctxt "TFRMOPTIONSFAVORITETABS.CBFULLEXPANDTREE.CAPTION"
msgid "Always expand tree"
msgstr ""
#: tfrmoptionsfavoritetabs.cbsavedirhistory.text
msgctxt "tfrmoptionsfavoritetabs.cbsavedirhistory.text"
msgid "No"
msgstr ""
#: tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelleftsavedtabs.text"
msgid "Left"
msgstr ""
#: tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text
msgctxt "tfrmoptionsfavoritetabs.cbtargetpanelrightsavedtabs.text"
msgid "Right"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabs.caption
msgid "Favorite Tabs list (reorder by drag && drop)"
msgstr ""
#: tfrmoptionsfavoritetabs.gbfavoritetabsotheroptions.caption
msgctxt "TFRMOPTIONSFAVORITETABS.GBFAVORITETABSOTHEROPTIONS.CAPTION"
msgid "Other options"
msgstr ""
#: tfrmoptionsfavoritetabs.gpsavedtabsrestorationaction.caption
msgid "What to restore where for the selected entry:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblexistingtabstokeep.caption
msgid "Existing tabs to keep:"
msgstr ""
#: tfrmoptionsfavoritetabs.lblsavedirhistory.caption
msgid "Save dir history:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelleftsavedtabs.caption
msgid "Tabs saved on left to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.lbltargetpanelrightsavedtabs.caption
msgid "Tabs saved on right to be restored to:"
msgstr ""
#: tfrmoptionsfavoritetabs.menuitem1.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM1.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsfavoritetabs.menuitem2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MENUITEM2.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddseparator.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSEPARATOR.CAPTION"
msgid "a separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddseparator2.caption
msgid "Add separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddsubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU.CAPTION"
msgid "sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miaddsubmenu2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIADDSUBMENU2.CAPTION"
msgid "Add sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.micollapseall.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICOLLAPSEALL.CAPTION"
msgid "Collapse all"
msgstr ""
#: tfrmoptionsfavoritetabs.micurrentlevelofitemonly.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICURRENTLEVELOFITEMONLY.CAPTION"
msgid "...current level of item(s) selected only"
msgstr ""
#: tfrmoptionsfavoritetabs.micutselection.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MICUTSELECTION.CAPTION"
msgid "Cut"
msgstr ""
#: tfrmoptionsfavoritetabs.mideleteallfavoritetabs.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEALLFAVORITETABS.CAPTION"
msgid "delete all!"
msgstr ""
#: tfrmoptionsfavoritetabs.mideletecompletesubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETECOMPLETESUBMENU.CAPTION"
msgid "sub-menu and all its elements"
msgstr ""
#: tfrmoptionsfavoritetabs.mideletejustsubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETEJUSTSUBMENU.CAPTION"
msgid "just sub-menu but keep elements"
msgstr ""
#: tfrmoptionsfavoritetabs.mideleteselectedentry.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY.CAPTION"
msgid "selected item"
msgstr ""
#: tfrmoptionsfavoritetabs.mideleteselectedentry2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIDELETESELECTEDENTRY2.CAPTION"
msgid "Delete selected item"
msgstr ""
#: tfrmoptionsfavoritetabs.miexporttolegacytabsfile.caption
msgid "Export selection to legacy .tab file(s)"
msgstr ""
#: tfrmoptionsfavoritetabs.mifavoritetabstestmenu.caption
msgid "FavoriteTabsTestMenu"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesaccsetting.caption
msgid "Import legacy .tab file(s) according to default setting"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIIMPORTLEGACYTABFILESATPOS.CAPTION"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption
msgctxt "tfrmoptionsfavoritetabs.miimportlegacytabfilesatpos1.caption"
msgid "Import legacy .tab file(s) at selected position"
msgstr ""
#: tfrmoptionsfavoritetabs.miimportlegacytabfilesinsubatpos.caption
msgid "Import legacy .tab file(s) at selected position in a sub menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertseparator.caption
msgid "Insert separator"
msgstr ""
#: tfrmoptionsfavoritetabs.miinsertsubmenu.caption
msgid "Insert sub-menu"
msgstr ""
#: tfrmoptionsfavoritetabs.miopenallbranches.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIOPENALLBRANCHES.CAPTION"
msgid "Open all branches"
msgstr ""
#: tfrmoptionsfavoritetabs.mipasteselection.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIPASTESELECTION.CAPTION"
msgid "Paste"
msgstr ""
#: tfrmoptionsfavoritetabs.mirename.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MIRENAME.CAPTION"
msgid "Rename"
msgstr ""
#: tfrmoptionsfavoritetabs.miseparator1.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR1.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsfavoritetabs.miseparator10.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR10.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsfavoritetabs.miseparator11.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR11.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsfavoritetabs.miseparator2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR2.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsfavoritetabs.miseparator3.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR3.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsfavoritetabs.miseparator7.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR7.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsfavoritetabs.miseparator8.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR8.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsfavoritetabs.miseparator9.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISEPARATOR9.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsfavoritetabs.misorteverything.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTEVERYTHING.CAPTION"
msgid "...everything, from A to Z!"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglegroup.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP.CAPTION"
msgid "...single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglegroup2.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLEGROUP2.CAPTION"
msgid "Sort single group of item(s) only"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsinglesubmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSINGLESUBMENU.CAPTION"
msgid "...content of submenu(s) selected, no sublevel"
msgstr ""
#: tfrmoptionsfavoritetabs.misortsubmenuandsublevel.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MISORTSUBMENUANDSUBLEVEL.CAPTION"
msgid "...content of submenu(s) selected and all sublevels"
msgstr ""
#: tfrmoptionsfavoritetabs.mitestresultingfavoritetabsmenu.caption
msgctxt "TFRMOPTIONSFAVORITETABS.MITESTRESULTINGFAVORITETABSMENU.CAPTION"
msgid "Test resulting menu"
msgstr ""
#: tfrmoptionsfileassoc.btnaddact.caption
msgid "Add"
msgstr ""
#: tfrmoptionsfileassoc.btnaddext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDEXT.CAPTION"
msgid "&Add"
msgstr ""
#: tfrmoptionsfileassoc.btnaddnewtype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNADDNEWTYPE.CAPTION"
msgid "A&dd"
msgstr ""
#: tfrmoptionsfileassoc.btncloneact.caption
msgid "Clone"
msgstr ""
#: tfrmoptionsfileassoc.btndownact.caption
msgid "&Down"
msgstr ""
#: tfrmoptionsfileassoc.btneditext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNEDITEXT.CAPTION"
msgid "Edit"
msgstr ""
#: tfrmoptionsfileassoc.btninsertact.caption
msgctxt "tfrmoptionsfileassoc.btninsertact.caption"
msgid "Insert"
msgstr ""
#: tfrmoptionsfileassoc.btninsertext.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNINSERTEXT.CAPTION"
msgid "Insert"
msgstr ""
#: tfrmoptionsfileassoc.btnremoveact.caption
msgid "Remo&ve"
msgstr ""
#: tfrmoptionsfileassoc.btnremoveext.caption
msgid "Re&move"
msgstr ""
#: tfrmoptionsfileassoc.btnremovetype.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNREMOVETYPE.CAPTION"
msgid "&Remove"
msgstr ""
#: tfrmoptionsfileassoc.btnrenametype.caption
msgctxt "tfrmoptionsfileassoc.btnrenametype.caption"
msgid "R&ename"
msgstr ""
#: tfrmoptionsfileassoc.btnupact.caption
msgctxt "TFRMOPTIONSFILEASSOC.BTNUPACT.CAPTION"
msgid "&Up"
msgstr ""
#: tfrmoptionsfileassoc.destartpath.hint
msgid "Starting path of the command. Never quote this string."
msgstr ""
#: tfrmoptionsfileassoc.edbactionname.hint
msgid "Name of the action. It is never passed to the system, it's just a mnemonic name chosen by you, for you"
msgstr ""
#: tfrmoptionsfileassoc.edtparams.hint
msgid "Parameter to pass to the command. Long filename with spaces should be quoted."
msgstr ""
#: tfrmoptionsfileassoc.fnecommand.hint
msgid "Command to execute. Long filename with space should be quoted."
msgstr ""
#: tfrmoptionsfileassoc.gbactiondescription.caption
msgid "Action description:"
msgstr ""
#: tfrmoptionsfileassoc.gbactions.caption
msgctxt "tfrmoptionsfileassoc.gbactions.caption"
msgid "Actions"
msgstr ""
#: tfrmoptionsfileassoc.gbexts.caption
msgid "Extensions"
msgstr ""
#: tfrmoptionsfileassoc.gbexts.hint
msgid "Can be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.gbfiletypes.caption
msgctxt "tfrmoptionsfileassoc.gbfiletypes.caption"
msgid "File types"
msgstr ""
#: tfrmoptionsfileassoc.gbicon.caption
msgid "Icon"
msgstr ""
#: tfrmoptionsfileassoc.lbactions.hint
msgid "Actions may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lbexts.hint
msgid "Extensions may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lbfiletypes.hint
msgid "File types may be sorted by drag & drop"
msgstr ""
#: tfrmoptionsfileassoc.lblaction.caption
msgid "Action name:"
msgstr ""
#: tfrmoptionsfileassoc.lblcommand.caption
msgid "&Command:"
msgstr ""
#: tfrmoptionsfileassoc.lblexternalparameters.caption
msgctxt "tfrmoptionsfileassoc.lblexternalparameters.caption"
msgid "Parameter&s:"
msgstr ""
#: tfrmoptionsfileassoc.lblstartpath.caption
msgctxt "tfrmoptionsfileassoc.lblstartpath.caption"
msgid "Start pat&h:"
msgstr ""
#: tfrmoptionsfileassoc.menuitem1.caption
msgctxt "TFRMOPTIONSFILEASSOC.MENUITEM1.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsfileassoc.menuitem3.caption
msgid "Custom with..."
msgstr ""
#: tfrmoptionsfileassoc.micustom.caption
msgid "Custom"
msgstr ""
#: tfrmoptionsfileassoc.miedit.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIEDIT.CAPTION"
msgid "Edit"
msgstr ""
#: tfrmoptionsfileassoc.mieditor.caption
msgid "Open in Editor"
msgstr ""
#: tfrmoptionsfileassoc.mieditwith.caption
msgid "Edit with..."
msgstr ""
#: tfrmoptionsfileassoc.migetoutputfromcommand.caption
msgid "Get output from command"
msgstr ""
#: tfrmoptionsfileassoc.miinternaleditor.caption
msgid "Open in Internal Editor"
msgstr ""
#: tfrmoptionsfileassoc.miinternalviewer.caption
msgid "Open in Internal Viewer"
msgstr ""
#: tfrmoptionsfileassoc.miopen.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIOPEN.CAPTION"
msgid "Open"
msgstr ""
#: tfrmoptionsfileassoc.miopenwith.caption
msgid "Open with..."
msgstr ""
#: tfrmoptionsfileassoc.miseparator.caption
msgctxt "TFRMOPTIONSFILEASSOC.MISEPARATOR.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionsfileassoc.mishell.caption
msgid "Run in terminal"
msgstr ""
#: tfrmoptionsfileassoc.miview.caption
msgctxt "TFRMOPTIONSFILEASSOC.MIVIEW.CAPTION"
msgid "View"
msgstr ""
#: tfrmoptionsfileassoc.miviewer.caption
msgid "Open in Viewer"
msgstr ""
#: tfrmoptionsfileassoc.miviewwith.caption
msgid "View with..."
msgstr ""
#: tfrmoptionsfileassoc.sbtnicon.hint
msgid "Click me to change icon!"
msgstr ""
#: tfrmoptionsfileassocextra.cbexecuteviashell.caption
msgctxt "tfrmoptionsfileassocextra.cbexecuteviashell.caption"
msgid "Execute via shell"
msgstr ""
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.caption
msgid "Extended context menu"
msgstr ""
#: tfrmoptionsfileassocextra.cbextendedcontextmenu.hint
msgctxt "TFRMOPTIONSFILEASSOCEXTRA.CBEXTENDEDCONTEXTMENU.HINT"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbincludeconfigfileassoc.caption
msgid "File association configuration"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.caption
msgid "Offer to add selection to file association when not included already"
msgstr ""
#: tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint
msgctxt "tfrmoptionsfileassocextra.cboffertoaddtofileassociations.hint"
msgid "When accessing file association, offer to add current selected file if not already included in a configured file type"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalclose.caption"
msgid "Execute via terminal and close"
msgstr ""
#: tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption
msgctxt "tfrmoptionsfileassocextra.cbopensystemwithterminalstayopen.caption"
msgid "Execute via terminal and stay open"
msgstr ""
#: tfrmoptionsfileassocextra.gbextendedcontextmenuoptions.caption
msgid "Extended options items:"
msgstr ""
#: tfrmoptionsfileoperations.bvlconfirmations.caption
msgid "Show confirmation window for:"
msgstr ""
#: tfrmoptionsfileoperations.cbcopyconfirmation.caption
msgid "Cop&y operation"
msgstr ""
#: tfrmoptionsfileoperations.cbdeleteconfirmation.caption
msgid "&Delete operation"
msgstr ""
#: tfrmoptionsfileoperations.cbdeletetotrash.caption
msgid "Dele&te to recycle bin (Shift key reverses this setting)"
msgstr ""
#: tfrmoptionsfileoperations.cbdeletetotrashconfirmation.caption
msgid "D&elete to trash operation"
msgstr ""
#: tfrmoptionsfileoperations.cbdropreadonlyflag.caption
msgid "D&rop readonly flag"
msgstr ""
#: tfrmoptionsfileoperations.cbmoveconfirmation.caption
msgid "&Move operation"
msgstr ""
#: tfrmoptionsfileoperations.cbprocesscomments.caption
msgid "&Process comments with files/folders"
msgstr ""
#: tfrmoptionsfileoperations.cbrenameselonlyname.caption
msgid "Select &file name without extension when renaming"
msgstr ""
#: tfrmoptionsfileoperations.cbshowcopytabselectpanel.caption
msgid "Sho&w tab select panel in copy/move dialog"
msgstr ""
#: tfrmoptionsfileoperations.cbskipfileoperror.caption
msgid "S&kip file operations errors and write them to log window"
msgstr ""
#: tfrmoptionsfileoperations.gbexecutingoperations.caption
msgid "Executing operations"
msgstr ""
#: tfrmoptionsfileoperations.gbuserinterface.caption
msgid "User interface"
msgstr ""
#: tfrmoptionsfileoperations.lblbuffersize.caption
msgid "&Buffer size for file operations (in KB):"
msgstr ""
#: tfrmoptionsfileoperations.lblhashbuffersize.caption
msgid "Buffer size for &hash calculation (in KB):"
msgstr ""
#: tfrmoptionsfileoperations.lblprogresskind.caption
msgid "Show operations progress &initially in"
msgstr ""
#: tfrmoptionsfileoperations.lbltypeofduplicatedrename.caption
msgid "Duplicated name auto-rename style:"
msgstr ""
#: tfrmoptionsfileoperations.lblwipepassnumber.caption
msgid "&Number of wipe passes:"
msgstr ""
#: tfrmoptionsfilepanelscolors.btnbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsfilepanelscolors.btnbackcolor2.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNBACKCOLOR2.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsfilepanelscolors.btncursorbordercolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORBORDERCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsfilepanelscolors.btncursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsfilepanelscolors.btncursortext.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNCURSORTEXT.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsfilepanelscolors.btnforecolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNFORECOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsfilepanelscolors.btninactivecursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVECURSORCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsfilepanelscolors.btninactivemarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINACTIVEMARKCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsfilepanelscolors.btnindbackcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDBACKCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsfilepanelscolors.btnindcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNINDCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsfilepanelscolors.btnmarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.BTNMARKCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsfilepanelscolors.btnresettodcdefault.caption
msgid "Reset to DC default"
msgstr ""
#: tfrmoptionsfilepanelscolors.cballowovercolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBALLOWOVERCOLOR.CAPTION"
msgid "Allow Overcolor"
msgstr ""
#: tfrmoptionsfilepanelscolors.cbbuseframecursor.caption
msgid "Use &Frame Cursor"
msgstr ""
#: tfrmoptionsfilepanelscolors.cbbusegradientind.caption
msgid "Use &Gradient Indicator"
msgstr ""
#: tfrmoptionsfilepanelscolors.cbbuseinactiveselcolor.caption
msgid "Use Inactive Sel Color"
msgstr ""
#: tfrmoptionsfilepanelscolors.cbbuseinvertedselection.caption
msgid "U&se Inverted Selection"
msgstr ""
#: tfrmoptionsfilepanelscolors.cbusecursorborder.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.CBUSECURSORBORDER.CAPTION"
msgid "Cursor border"
msgstr ""
#: tfrmoptionsfilepanelscolors.dbfreespaceindicator.caption
msgid "Drive Free Space Indicator"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor.caption
msgid "Bac&kground:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblbackgroundcolor2.caption
msgid "Backg&round 2:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblcursorcolor.caption
msgid "C&ursor Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblcursortext.caption
msgid "Cursor Te&xt:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivecursorcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVECURSORCOLOR.CAPTION"
msgid "Inactive Cursor Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivemarkcolor.caption
msgctxt "TFRMOPTIONSFILEPANELSCOLORS.LBLINACTIVEMARKCOLOR.CAPTION"
msgid "Inactive Mark Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblinactivepanelbrightness.caption
msgid "&Brightness level of inactive panel"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblindbackcolor.caption
msgid "In&dicator Back Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblindcolor.caption
msgid "&Indicator Fore Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblmarkcolor.caption
msgid "&Mark Color:"
msgstr ""
#: tfrmoptionsfilepanelscolors.lblpreview.caption
msgid "Below is a preview. You may move cursor, select file and get immediately an actual look and feel of the various settings."
msgstr ""
#: tfrmoptionsfilepanelscolors.lbltextcolor.caption
msgid "T&ext Color:"
msgstr ""
#: tfrmoptionsfilesearch.cbinitiallyclearfilemask.caption
msgid "When launching file search, clear file mask filter"
msgstr ""
#: tfrmoptionsfilesearch.cbpartialnamesearch.caption
msgid "&Search for part of file name"
msgstr ""
#: tfrmoptionsfilesearch.cbshowmenubarinfindfiles.caption
msgid "Show menu bar in \"Find files\""
msgstr ""
#: tfrmoptionsfilesearch.dbtextsearch.caption
msgid "Text search in files"
msgstr ""
#: tfrmoptionsfilesearch.gbfilesearch.caption
msgctxt "TFRMOPTIONSFILESEARCH.GBFILESEARCH.CAPTION"
msgid "File search"
msgstr ""
#: tfrmoptionsfilesearch.lblnewsearchfilters.caption
msgid "Current filters with \"New search\" button:"
msgstr ""
#: tfrmoptionsfilesearch.lblsearchdefaulttemplate.caption
msgid "Default search template:"
msgstr ""
#: tfrmoptionsfilesearch.rbusemmapinsearch.caption
msgid "Use memory mapping for search te&xt in files"
msgstr ""
#: tfrmoptionsfilesearch.rbusestreaminsearch.caption
msgid "&Use stream for search text in files"
msgstr ""
#: tfrmoptionsfilesviews.btnaddattribute.caption
msgctxt "TFRMOPTIONSFILESVIEWS.BTNADDATTRIBUTE.CAPTION"
msgid "&Add"
msgstr ""
#: tfrmoptionsfilesviews.btnattrshelp.caption
msgctxt "TFRMOPTIONSFILESVIEWS.BTNATTRSHELP.CAPTION"
msgid "&Help"
msgstr ""
#: tfrmoptionsfilesviews.cbdblclicktoparent.caption
msgid "Enable changing to &parent folder when double-clicking on empty part of file view"
msgstr ""
#: tfrmoptionsfilesviews.cbdelayloadingtabs.caption
msgid "Do&n't load file list until a tab is activated"
msgstr ""
#: tfrmoptionsfilesviews.cbdirbrackets.caption
msgid "S&how square brackets around directories"
msgstr ""
#: tfrmoptionsfilesviews.cbhighlightupdatedfiles.caption
msgid "Hi&ghlight new and updated files"
msgstr ""
#: tfrmoptionsfilesviews.cbinplacerename.caption
msgid "Enable inplace &renaming when clicking twice on a name"
msgstr ""
#: tfrmoptionsfilesviews.cblistfilesinthread.caption
msgid "Load &file list in separate thread"
msgstr ""
#: tfrmoptionsfilesviews.cbloadiconsseparately.caption
msgid "Load icons af&ter file list"
msgstr ""
#: tfrmoptionsfilesviews.cbshowsystemfiles.caption
msgid "Show s&ystem and hidden files"
msgstr ""
#: tfrmoptionsfilesviews.cbspacemovesdown.caption
msgid "&When selecting files with <SPACEBAR>, move down to next file (as with <INSERT>)"
msgstr ""
#: tfrmoptionsfilesviews.chkmarkmaskfilterwindows.caption
msgid "Windows style filter when marking files (\"*.*\" also select files without extension, etc.)"
msgstr ""
#: tfrmoptionsfilesviews.chkmarkmaskshowattribute.caption
msgid "Use an independant attribute filter in mask input dialog each time"
msgstr ""
#: tfrmoptionsfilesviews.gbformatting.caption
msgid "Formatting"
msgstr ""
#: tfrmoptionsfilesviews.gbmarking.caption
msgid "Marking/Unmarking entries"
msgstr ""
#: tfrmoptionsfilesviews.gbsorting.caption
msgid "Sorting"
msgstr ""
#: tfrmoptionsfilesviews.lbattributemask.caption
msgid "Default attribute mask value to use:"
msgstr ""
#: tfrmoptionsfilesviews.lblcasesensitivity.caption
msgid "Case s&ensitivity:"
msgstr ""
#: tfrmoptionsfilesviews.lbldatetimeexample.caption
msgid "Incorrect format"
msgstr ""
#: tfrmoptionsfilesviews.lbldatetimeformat.caption
msgid "&Date and time format:"
msgstr ""
#: tfrmoptionsfilesviews.lblfilesizeformat.caption
msgid "File si&ze format:"
msgstr ""
#: tfrmoptionsfilesviews.lblnewfilesposition.caption
msgid "&Insert new files:"
msgstr ""
#: tfrmoptionsfilesviews.lblsortfoldermode.caption
msgid "So&rting directories:"
msgstr ""
#: tfrmoptionsfilesviews.lblsortmethod.caption
msgid "&Sort method:"
msgstr ""
#: tfrmoptionsfilesviews.lblupdatedfilesposition.caption
msgid "&Move updated files:"
msgstr ""
#: tfrmoptionsfiletypescolors.btnaddcategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNADDCATEGORY.CAPTION"
msgid "A&dd"
msgstr ""
#: tfrmoptionsfiletypescolors.btnapplycategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNAPPLYCATEGORY.CAPTION"
msgid "A&pply"
msgstr ""
#: tfrmoptionsfiletypescolors.btncategorycolor.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNCATEGORYCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsfiletypescolors.btndeletecategory.caption
msgctxt "TFRMOPTIONSFILETYPESCOLORS.BTNDELETECATEGORY.CAPTION"
msgid "D&elete"
msgstr ""
#: tfrmoptionsfiletypescolors.btnsearchtemplate.hint
msgctxt "tfrmoptionsfiletypescolors.btnsearchtemplate.hint"
msgid "Template..."
msgstr ""
#: tfrmoptionsfiletypescolors.gbfiletypescolors.caption
msgid "File types colors (sort by drag&&drop)"
msgstr ""
#: tfrmoptionsfiletypescolors.lblcategoryattr.caption
msgid "Category a&ttributes:"
msgstr ""
#: tfrmoptionsfiletypescolors.lblcategorycolor.caption
msgid "Category co&lor:"
msgstr ""
#: tfrmoptionsfiletypescolors.lblcategorymask.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategorymask.caption"
msgid "Category &mask:"
msgstr ""
#: tfrmoptionsfiletypescolors.lblcategoryname.caption
msgctxt "tfrmoptionsfiletypescolors.lblcategoryname.caption"
msgid "Category &name:"
msgstr ""
#: tfrmoptionsfonts.btnpatheditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNPATHEDITFNT.CAPTION"
msgid "..."
msgstr ""
#: tfrmoptionsfonts.btnsearchresultsfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSEARCHRESULTSFNT.CAPTION"
msgid "..."
msgstr ""
#: tfrmoptionsfonts.btnselconsolefnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELCONSOLEFNT.CAPTION"
msgid "..."
msgstr ""
#: tfrmoptionsfonts.btnseleditfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELEDITFNT.CAPTION"
msgid "..."
msgstr ""
#: tfrmoptionsfonts.btnsellogfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELLOGFNT.CAPTION"
msgid "..."
msgstr ""
#: tfrmoptionsfonts.btnselmainfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELMAINFNT.CAPTION"
msgid "..."
msgstr ""
#: tfrmoptionsfonts.btnselviewerbookfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWERBOOKFNT.CAPTION"
msgid "..."
msgstr ""
#: tfrmoptionsfonts.btnselviewfnt.caption
msgctxt "TFRMOPTIONSFONTS.BTNSELVIEWFNT.CAPTION"
msgid "..."
msgstr ""
#: tfrmoptionsfonts.lblconsolefont.caption
msgid "&Console font"
msgstr ""
#: tfrmoptionsfonts.lbleditorfont.caption
msgid "&Editor font"
msgstr ""
#: tfrmoptionsfonts.lbllogfont.caption
msgid "&Log font"
msgstr ""
#: tfrmoptionsfonts.lblmainfont.caption
msgid "Main &font"
msgstr ""
#: tfrmoptionsfonts.lblpatheditfont.caption
msgid "Path font"
msgstr ""
#: tfrmoptionsfonts.lblsearchresultsfont.caption
msgid "Search results font"
msgstr ""
#: tfrmoptionsfonts.lblviewerbookfont.caption
msgid "Viewer&Book Font"
msgstr ""
#: tfrmoptionsfonts.lblviewerfont.caption
msgid "&Viewer font"
msgstr ""
#: tfrmoptionshotkeys.actaddhotkey.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTADDHOTKEY.CAPTION"
msgid "Add &hotkey"
msgstr ""
#: tfrmoptionshotkeys.actcopy.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTCOPY.CAPTION"
msgid "Copy"
msgstr ""
#: tfrmoptionshotkeys.actdelete.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETE.CAPTION"
msgid "Delete"
msgstr ""
#: tfrmoptionshotkeys.actdeletehotkey.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTDELETEHOTKEY.CAPTION"
msgid "&Delete hotkey"
msgstr ""
#: tfrmoptionshotkeys.actedithotkey.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTEDITHOTKEY.CAPTION"
msgid "&Edit hotkey"
msgstr ""
#: tfrmoptionshotkeys.actnextcategory.caption
msgid "Next category"
msgstr ""
#: tfrmoptionshotkeys.actpopupfilerelatedmenu.caption
msgid "Make popup the file related menu"
msgstr ""
#: tfrmoptionshotkeys.actpreviouscategory.caption
msgid "Previous category"
msgstr ""
#: tfrmoptionshotkeys.actrename.caption
msgctxt "TFRMOPTIONSHOTKEYS.ACTRENAME.CAPTION"
msgid "Rename"
msgstr ""
#: tfrmoptionshotkeys.actrestoredefault.caption
msgid "Restore DC default"
msgstr ""
#: tfrmoptionshotkeys.actsavenow.caption
msgid "Save now"
msgstr ""
#: tfrmoptionshotkeys.actsortbycommand.caption
msgid "Sort by command name"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysgrouped.caption
msgid "Sort by hotkeys (grouped)"
msgstr ""
#: tfrmoptionshotkeys.actsortbyhotkeysoneperline.caption
msgid "Sort by hotkeys (one per row)"
msgstr ""
#: tfrmoptionshotkeys.lbfilter.caption
msgid "&Filter"
msgstr ""
#: tfrmoptionshotkeys.lblcategories.caption
msgid "C&ategories:"
msgstr ""
#: tfrmoptionshotkeys.lblcommands.caption
msgid "Co&mmands:"
msgstr ""
#: tfrmoptionshotkeys.lblscfiles.caption
msgid "&Shortcut files:"
msgstr ""
#: tfrmoptionshotkeys.lblsortorder.caption
msgid "So&rt order:"
msgstr ""
#: tfrmoptionshotkeys.micategories.caption
msgid "Categories"
msgstr ""
#: tfrmoptionshotkeys.micommands.caption
msgctxt "TFRMOPTIONSHOTKEYS.MICOMMANDS.CAPTION"
msgid "Command"
msgstr ""
#: tfrmoptionshotkeys.miseparator1.caption
msgctxt "TFRMOPTIONSHOTKEYS.MISEPARATOR1.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionshotkeys.misortorder.caption
msgid "Sort order"
msgstr ""
#: tfrmoptionsicons.cbiconsexclude.caption
msgctxt "TFRMOPTIONSICONS.CBICONSEXCLUDE.CAPTION"
msgid "For the following &paths and their subdirectories:"
msgstr ""
#: tfrmoptionsicons.cbiconsinmenus.caption
msgid "Show icons for actions in &menus"
msgstr ""
#: tfrmoptionsicons.cbiconsinmenussize.text
msgctxt "TFRMOPTIONSICONS.CBICONSINMENUSSIZE.TEXT"
msgid "16x16"
msgstr ""
#: tfrmoptionsicons.cbiconsonbuttons.caption
msgid "Show icons on buttons"
msgstr ""
#: tfrmoptionsicons.cbiconsshowoverlay.caption
msgid "Show o&verlay icons, e.g. for links"
msgstr ""
#: tfrmoptionsicons.gbdisablespecialicons.caption
msgid "Disable special icons"
msgstr ""
#: tfrmoptionsicons.gbiconsinmenus.caption
msgid "Icons in menus"
msgstr ""
#: tfrmoptionsicons.gbiconsonbuttons.caption
msgid "Icons on buttons"
msgstr ""
#: tfrmoptionsicons.gbiconssize.caption
msgid " Icon size "
msgstr ""
#: tfrmoptionsicons.gbshowiconsmode.caption
msgid " Show icons to the left of the filename "
msgstr ""
#: tfrmoptionsicons.lbldiskpanel.caption
msgid "Disk panel:"
msgstr ""
#: tfrmoptionsicons.lblfilepanel.caption
msgid "File panel:"
msgstr ""
#: tfrmoptionsicons.rbiconsshowall.caption
msgctxt "tfrmoptionsicons.rbiconsshowall.caption"
msgid "A&ll"
msgstr ""
#: tfrmoptionsicons.rbiconsshowallandexe.caption
msgid "All associated + &EXE/LNK (slow)"
msgstr ""
#: tfrmoptionsicons.rbiconsshownone.caption
msgid "&No icons"
msgstr ""
#: tfrmoptionsicons.rbiconsshowstandard.caption
msgid "Only &standard icons"
msgstr ""
#: tfrmoptionsignorelist.btnaddsel.caption
msgid "A&dd selected names"
msgstr ""
#: tfrmoptionsignorelist.btnaddselwithpath.caption
msgid "Add selected names with &full path"
msgstr ""
#: tfrmoptionsignorelist.btnrelativesavein.hint
msgctxt "TFRMOPTIONSIGNORELIST.BTNRELATIVESAVEIN.HINT"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsignorelist.chkignoreenable.caption
msgid "&Ignore (don't show) the following files and folders:"
msgstr ""
#: tfrmoptionsignorelist.lblsavein.caption
msgid "&Save in:"
msgstr ""
#: tfrmoptionskeyboard.cblynxlike.caption
msgid "Le&ft, Right arrows change directory (Lynx-like movement)"
msgstr ""
#: tfrmoptionskeyboard.gbtyping.caption
msgid "Typing"
msgstr ""
#: tfrmoptionskeyboard.lblalt.caption
msgid "Alt+L&etters:"
msgstr ""
#: tfrmoptionskeyboard.lblctrlalt.caption
msgid "Ctrl+Alt+Le&tters:"
msgstr ""
#: tfrmoptionskeyboard.lblnomodifier.caption
msgid "&Letters:"
msgstr ""
#: tfrmoptionslayout.cbflatdiskpanel.caption
msgctxt "tfrmoptionslayout.cbflatdiskpanel.caption"
msgid "&Flat buttons"
msgstr ""
#: tfrmoptionslayout.cbflatinterface.caption
msgid "Flat i&nterface"
msgstr ""
#: tfrmoptionslayout.cbflattoolbar.caption
msgid "Flat b&uttons"
msgstr ""
#: tfrmoptionslayout.cbfreespaceind.caption
msgid "Show fr&ee space indicator on drive label"
msgstr ""
#: tfrmoptionslayout.cblogwindow.caption
msgid "Show lo&g window"
msgstr ""
#: tfrmoptionslayout.cbpanelofoperations.caption
msgid "Show panel of operation in background"
msgstr ""
#: tfrmoptionslayout.cbproginmenubar.caption
msgid "Show common progress in menu bar"
msgstr ""
#: tfrmoptionslayout.cbshowcmdline.caption
msgid "Show command l&ine"
msgstr ""
#: tfrmoptionslayout.cbshowcurdir.caption
msgid "Show current director&y"
msgstr ""
#: tfrmoptionslayout.cbshowdiskpanel.caption
msgid "Show &drive buttons"
msgstr ""
#: tfrmoptionslayout.cbshowdrivefreespace.caption
msgid "Show free s&pace label"
msgstr ""
#: tfrmoptionslayout.cbshowdriveslistbutton.caption
msgid "Show drives list bu&tton"
msgstr ""
#: tfrmoptionslayout.cbshowkeyspanel.caption
msgid "Show function &key buttons"
msgstr ""
#: tfrmoptionslayout.cbshowmainmenu.caption
msgid "Show &main menu"
msgstr ""
#: tfrmoptionslayout.cbshowmaintoolbar.caption
msgid "Show tool&bar"
msgstr ""
#: tfrmoptionslayout.cbshowshortdrivefreespace.caption
msgid "Show short free space &label"
msgstr ""
#: tfrmoptionslayout.cbshowstatusbar.caption
msgid "Show &status bar"
msgstr ""
#: tfrmoptionslayout.cbshowtabheader.caption
msgid "S&how tabstop header"
msgstr ""
#: tfrmoptionslayout.cbshowtabs.caption
msgid "Sho&w folder tabs"
msgstr ""
#: tfrmoptionslayout.cbtermwindow.caption
msgid "Show te&rminal window"
msgstr ""
#: tfrmoptionslayout.cbtwodiskpanels.caption
msgid "Show two drive button bars (fi&xed width, above file windows)"
msgstr ""
#: tfrmoptionslayout.gbscreenlayout.caption
msgid " Screen layout "
msgstr ""
#: tfrmoptionslog.btnrelativelogfile.hint
msgctxt "TFRMOPTIONSLOG.BTNRELATIVELOGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionslog.btnviewlogfile.hint
msgctxt "tfrmoptionslog.btnviewlogfile.hint"
msgid "View log file content"
msgstr ""
#: tfrmoptionslog.cbincludedateinlogfilename.caption
msgid "Include date in log filename"
msgstr ""
#: tfrmoptionslog.cblogarcop.caption
msgid "&Pack/Unpack"
msgstr ""
#: tfrmoptionslog.cblogcommandlineexecution.caption
msgid "External command line execution"
msgstr ""
#: tfrmoptionslog.cblogcpmvln.caption
msgid "Cop&y/Move/Create link/symlink"
msgstr ""
#: tfrmoptionslog.cblogdelete.caption
msgctxt "TFRMOPTIONSLOG.CBLOGDELETE.CAPTION"
msgid "&Delete"
msgstr ""
#: tfrmoptionslog.cblogdirop.caption
msgid "Crea&te/Delete directories"
msgstr ""
#: tfrmoptionslog.cblogerrors.caption
msgid "Log &errors"
msgstr ""
#: tfrmoptionslog.cblogfile.caption
msgid "C&reate a log file:"
msgstr ""
#: tfrmoptionslog.cbloginfo.caption
msgid "Log &information messages"
msgstr ""
#: tfrmoptionslog.cblogstartshutdown.caption
msgid "Start/shutdown"
msgstr ""
#: tfrmoptionslog.cblogsuccess.caption
msgid "Log &successful operations"
msgstr ""
#: tfrmoptionslog.cblogvfs.caption
msgid "&File system plugins"
msgstr ""
#: tfrmoptionslog.gblogfile.caption
msgid "File operation log file"
msgstr ""
#: tfrmoptionslog.gblogfileop.caption
msgid "Log operations"
msgstr ""
#: tfrmoptionslog.gblogfilestatus.caption
msgid "Operation status"
msgstr ""
#: tfrmoptionsmisc.btnoutputpathfortoolbar.caption
msgctxt "TFRMOPTIONSMISC.BTNOUTPUTPATHFORTOOLBAR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsmisc.btnrelativeoutputpathfortoolbar.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVEOUTPUTPATHFORTOOLBAR.HINT"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnrelativetcconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCCONFIGFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnrelativetcexecutablefile.hint
msgctxt "TFRMOPTIONSMISC.BTNRELATIVETCEXECUTABLEFILE.HINT"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionsmisc.btnthumbcompactcache.caption
msgid "&Remove thumbnails for no longer existing files"
msgstr ""
#: tfrmoptionsmisc.btnviewconfigfile.hint
msgctxt "TFRMOPTIONSMISC.BTNVIEWCONFIGFILE.HINT"
msgid "View log file content"
msgstr ""
#: tfrmoptionsmisc.chkdesccreateunicode.caption
msgctxt "TFRMOPTIONSMISC.CHKDESCCREATEUNICODE.CAPTION"
msgid "Create new with the encoding:"
msgstr ""
#: tfrmoptionsmisc.chkgotoroot.caption
msgid "Always &go to the root of a drive when changing drives"
msgstr ""
#: tfrmoptionsmisc.chkshowwarningmessages.caption
msgid "Show &warning messages (\"OK\" button only)"
msgstr ""
#: tfrmoptionsmisc.chkthumbsave.caption
msgid "&Save thumbnails in cache"
msgstr ""
#: tfrmoptionsmisc.dblthumbnails.caption
msgctxt "TFRMOPTIONSMISC.DBLTHUMBNAILS.CAPTION"
msgid "Thumbnails"
msgstr ""
#: tfrmoptionsmisc.gbfilecomments.caption
msgid "File comments (descript.ion)"
msgstr ""
#: tfrmoptionsmisc.gbtcexportimport.caption
msgid "Regarding TC export/import:"
msgstr ""
#: tfrmoptionsmisc.lbldescrdefaultencoding.caption
msgctxt "TFRMOPTIONSMISC.LBLDESCRDEFAULTENCODING.CAPTION"
msgid "Default encoding:"
msgstr ""
#: tfrmoptionsmisc.lbltcconfig.caption
msgid "Configuration file:"
msgstr ""
#: tfrmoptionsmisc.lbltcexecutable.caption
msgid "TC executable:"
msgstr ""
#: tfrmoptionsmisc.lbltcpathfortool.caption
msgid "Toolbar output path:"
msgstr ""
#: tfrmoptionsmisc.lblthumbpixels.caption
msgid "pixels"
msgstr ""
#: tfrmoptionsmisc.lblthumbseparator.caption
msgctxt "tfrmoptionsmisc.lblthumbseparator.caption"
msgid "X"
msgstr ""
#: tfrmoptionsmisc.lblthumbsize.caption
msgid "&Thumbnail size:"
msgstr ""
#: tfrmoptionsmouse.cbselectionbymouse.caption
msgid "&Selection by mouse"
msgstr ""
#: tfrmoptionsmouse.gbscrolling.caption
msgid "Scrolling"
msgstr ""
#: tfrmoptionsmouse.gbselection.caption
msgid "Selection"
msgstr ""
#: tfrmoptionsmouse.lblmousemode.caption
msgid "&Mode:"
msgstr ""
#: tfrmoptionsmouse.rbscrolllinebyline.caption
msgid "&Line by line"
msgstr ""
#: tfrmoptionsmouse.rbscrolllinebylinecursor.caption
msgid "Line by line &with cursor movement"
msgstr ""
#: tfrmoptionsmouse.rbscrollpagebypage.caption
msgid "&Page by page"
msgstr ""
#: tfrmoptionsplugins.btnaddplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNADDPLUGIN.CAPTION"
msgid "A&dd"
msgstr ""
#: tfrmoptionsplugins.btnconfigplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNCONFIGPLUGIN.CAPTION"
msgid "Con&figure"
msgstr ""
#: tfrmoptionsplugins.btnenableplugin.caption
msgid "E&nable"
msgstr ""
#: tfrmoptionsplugins.btnremoveplugin.caption
msgctxt "TFRMOPTIONSPLUGINS.BTNREMOVEPLUGIN.CAPTION"
msgid "&Remove"
msgstr ""
#: tfrmoptionsplugins.btntweakplugin.caption
msgid "&Tweak"
msgstr ""
#: tfrmoptionsplugins.lbldsxdescription.caption
msgid "Searc&h plugins allow one to use alternative search algorithms or external tools (like \"locate\", etc.)"
msgstr ""
#: tfrmoptionsplugins.lblwcxdescription.caption
msgid "Pack&er plugins are used to work with archives"
msgstr ""
#: tfrmoptionsplugins.lblwdxdescription.caption
msgid "Content plu&gins allow one to display extended file details like mp3 tags or image attributes in file lists, or use them in search and multi-rename tool"
msgstr ""
#: tfrmoptionsplugins.lblwfxdescription.caption
msgid "Fi&le system plugins allow access to disks inaccessible by operating system or to external devices like Palm/PocketPC."
msgstr ""
#: tfrmoptionsplugins.lblwlxdescription.caption
msgid "Vie&wer plugins allow one to display file formats like images, spreadsheets, databases etc. in Viewer (F3, Ctrl+Q)"
msgstr ""
#: tfrmoptionsplugins.stgplugins.columns[0].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[0].title.caption"
msgid "Active"
msgstr ""
#: tfrmoptionsplugins.stgplugins.columns[1].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[1].TITLE.CAPTION"
msgid "Plugin"
msgstr ""
#: tfrmoptionsplugins.stgplugins.columns[2].title.caption
msgctxt "tfrmoptionsplugins.stgplugins.columns[2].title.caption"
msgid "Registered for"
msgstr ""
#: tfrmoptionsplugins.stgplugins.columns[3].title.caption
msgctxt "TFRMOPTIONSPLUGINS.STGPLUGINS.COLUMNS[3].TITLE.CAPTION"
msgid "File name"
msgstr ""
#: tfrmoptionsplugins.tsdsx.caption
msgid "&Search plugins (.DSX)"
msgstr ""
#: tfrmoptionsplugins.tswcx.caption
msgid "Pac&ker plugins (.WCX)"
msgstr ""
#: tfrmoptionsplugins.tswdx.caption
msgid "Content pl&ugins (.WDX)"
msgstr ""
#: tfrmoptionsplugins.tswfx.caption
msgid "F&ile system plugins (.WFX)"
msgstr ""
#: tfrmoptionsplugins.tswlx.caption
msgid "&Viewer plugins (.WLX)"
msgstr ""
#: tfrmoptionsquicksearchfilter.cbexactbeginning.caption
msgid "&Beginning (name must start with first typed character)"
msgstr ""
#: tfrmoptionsquicksearchfilter.cbexactending.caption
msgid "En&ding (last character before a typed dot . must match)"
msgstr ""
#: tfrmoptionsquicksearchfilter.cgpoptions.caption
msgctxt "TFRMOPTIONSQUICKSEARCHFILTER.CGPOPTIONS.CAPTION"
msgid "Options"
msgstr ""
#: tfrmoptionsquicksearchfilter.gbexactnamematch.caption
msgid "Exact name match"
msgstr ""
#: tfrmoptionsquicksearchfilter.rgpsearchcase.caption
msgid "Search case"
msgstr ""
#: tfrmoptionsquicksearchfilter.rgpsearchitems.caption
msgid "Search for these items"
msgstr ""
#: tfrmoptionstabs.cbkeeprenamednamebacktonormal.caption
msgid "Keep renamed name when unlocking a tab"
msgstr ""
#: tfrmoptionstabs.cbtabsactivateonclick.caption
msgid "Activate target &panel when clicking on one of its Tabs"
msgstr ""
#: tfrmoptionstabs.cbtabsalwaysvisible.caption
msgid "&Show tab header also when there is only one tab"
msgstr ""
#: tfrmoptionstabs.cbtabscloseduplicatewhenclosing.caption
msgid "Close duplicate tabs when closing application"
msgstr ""
#: tfrmoptionstabs.cbtabsconfirmcloseall.caption
msgid "Con&firm close all tabs"
msgstr ""
#: tfrmoptionstabs.cbtabsconfirmcloselocked.caption
msgid "Confirm close locked tabs"
msgstr ""
#: tfrmoptionstabs.cbtabslimitoption.caption
msgid "&Limit tab title length to"
msgstr ""
#: tfrmoptionstabs.cbtabslockedasterisk.caption
msgid "Show locked tabs &with an asterisk *"
msgstr ""
#: tfrmoptionstabs.cbtabsmultilines.caption
msgid "&Tabs on multiple lines"
msgstr ""
#: tfrmoptionstabs.cbtabsopenforeground.caption
msgid "Ctrl+&Up opens new tab in foreground"
msgstr ""
#: tfrmoptionstabs.cbtabsopennearcurrent.caption
msgid "Open &new tabs near current tab"
msgstr ""
#: tfrmoptionstabs.cbtabsreusetabwhenpossible.caption
msgid "Reuse existing tab when possible"
msgstr ""
#: tfrmoptionstabs.cbtabsshowclosebutton.caption
msgid "Show ta&b close button"
msgstr ""
#: tfrmoptionstabs.cbtabsshowdriveletter.caption
msgid "Always show drive letter in tab title"
msgstr ""
#: tfrmoptionstabs.gbtabs.caption
msgid "Folder tabs headers"
msgstr ""
#: tfrmoptionstabs.lblchar.caption
msgid "characters"
msgstr ""
#: tfrmoptionstabs.lbltabsactionondoubleclick.caption
msgid "Action to do when double click on a tab:"
msgstr ""
#: tfrmoptionstabs.lbltabsposition.caption
msgid "Ta&bs position"
msgstr ""
#: tfrmoptionstabsextra.cbdefaultexistingtabstokeep.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTEXISTINGTABSTOKEEP.TEXT"
msgid "None"
msgstr ""
#: tfrmoptionstabsextra.cbdefaultsavedirhistory.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTSAVEDIRHISTORY.TEXT"
msgid "No"
msgstr ""
#: tfrmoptionstabsextra.cbdefaulttargetpanelleftsaved.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELLEFTSAVED.TEXT"
msgid "Left"
msgstr ""
#: tfrmoptionstabsextra.cbdefaulttargetpanelrightsaved.text
msgctxt "TFRMOPTIONSTABSEXTRA.CBDEFAULTTARGETPANELRIGHTSAVED.TEXT"
msgid "Right"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigafterresave.caption
msgid "Goto to Favorite Tabs Configuration after resaving"
msgstr ""
#: tfrmoptionstabsextra.cbgotoconfigaftersave.caption
msgid "Goto to Favorite Tabs Configuration after saving a new one"
msgstr ""
#: tfrmoptionstabsextra.cbusefavoritetabsextraoptions.caption
msgid "Enable Favorite Tabs extra options (select target side when restore, etc.)"
msgstr ""
#: tfrmoptionstabsextra.gbdefaulttabsavedrestoration.caption
msgid "Default extra settings when saving new Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.gbtabs.caption
msgid "Folder tabs headers extra"
msgstr ""
#: tfrmoptionstabsextra.lbldefaultexistingtabstokeep.caption
msgid "When restoring tab, existing tabs to keep:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelleftsaved.caption
msgid "Tabs saved on left will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lbldefaulttargetpanelrightsaved.caption
msgid "Tabs saved on right will be restored to:"
msgstr ""
#: tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption
msgctxt "tfrmoptionstabsextra.lblfavoritetabssavedirhistory.caption"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: tfrmoptionstabsextra.rgwheretoadd.caption
msgid "Default position in menu when saving a new Favorite Tabs:"
msgstr ""
#: tfrmoptionsterminal.edrunintermcloseparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMCLOSEPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edrunintermstayopenparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNINTERMSTAYOPENPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.edruntermparams.hint
msgctxt "TFRMOPTIONSTERMINAL.EDRUNTERMPARAMS.HINT"
msgid "{command} should normally be present here to reflect the command to be run in terminal"
msgstr ""
#: tfrmoptionsterminal.gbjustrunterminal.caption
msgid "Command for just running terminal:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalclose.caption
msgid "Command for running a command in terminal and close after:"
msgstr ""
#: tfrmoptionsterminal.gbruninterminalstayopen.caption
msgid "Command for running a command in terminal and stay open:"
msgstr ""
#: tfrmoptionsterminal.lbrunintermclosecmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSECMD.CAPTION"
msgid "Command:"
msgstr ""
#: tfrmoptionsterminal.lbrunintermcloseparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMCLOSEPARAMS.CAPTION"
msgid "Parameters:"
msgstr ""
#: tfrmoptionsterminal.lbrunintermstayopencmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENCMD.CAPTION"
msgid "Command:"
msgstr ""
#: tfrmoptionsterminal.lbrunintermstayopenparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNINTERMSTAYOPENPARAMS.CAPTION"
msgid "Parameters:"
msgstr ""
#: tfrmoptionsterminal.lbruntermcmd.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMCMD.CAPTION"
msgid "Command:"
msgstr ""
#: tfrmoptionsterminal.lbruntermparams.caption
msgctxt "TFRMOPTIONSTERMINAL.LBRUNTERMPARAMS.CAPTION"
msgid "Parameters:"
msgstr ""
#: tfrmoptionstoolbar.btnclonebutton.caption
msgid "C&lone button"
msgstr ""
#: tfrmoptionstoolbar.btndeletebutton.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNDELETEBUTTON.CAPTION"
msgid "&Delete"
msgstr ""
#: tfrmoptionstoolbar.btnedithotkey.caption
msgid "Edit hot&key"
msgstr ""
#: tfrmoptionstoolbar.btninsertbutton.caption
msgid "&Insert new button"
msgstr ""
#: tfrmoptionstoolbar.btnopencmddlg.caption
msgid "Select"
msgstr ""
#: tfrmoptionstoolbar.btnopenfile.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNOPENFILE.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstoolbar.btnother.caption
msgctxt "tfrmoptionstoolbar.btnother.caption"
msgid "Other..."
msgstr ""
#: tfrmoptionstoolbar.btnremovehotkey.caption
msgid "Remove hotke&y"
msgstr ""
#: tfrmoptionstoolbar.btnstartpath.caption
msgctxt "TFRMOPTIONSTOOLBAR.BTNSTARTPATH.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstoolbar.btnsuggestiontooltip.caption
msgid "Suggest"
msgstr ""
#: tfrmoptionstoolbar.btnsuggestiontooltip.hint
msgid "Have DC suggest the tooltip based on button type, command and parameters"
msgstr ""
#: tfrmoptionstoolbar.cbflatbuttons.caption
msgctxt "TFRMOPTIONSTOOLBAR.CBFLATBUTTONS.CAPTION"
msgid "&Flat buttons"
msgstr ""
#: tfrmoptionstoolbar.cbreporterrorwithcommands.caption
msgid "Report errors with commands"
msgstr ""
#: tfrmoptionstoolbar.edtinternalparameters.hint
msgid "Enter command parameters, each in a separate line. Press F1 to see help on parameters."
msgstr ""
#: tfrmoptionstoolbar.gbgroupbox.caption
msgid "Appearance"
msgstr ""
#: tfrmoptionstoolbar.lblbarsize.caption
msgid "&Bar size:"
msgstr ""
#: tfrmoptionstoolbar.lblexternalcommand.caption
msgid "Comman&d:"
msgstr ""
#: tfrmoptionstoolbar.lblexternalparameters.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLEXTERNALPARAMETERS.CAPTION"
msgid "Parameter&s:"
msgstr ""
#: tfrmoptionstoolbar.lblhelponinternalcommand.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLHELPONINTERNALCOMMAND.CAPTION"
msgid "Help"
msgstr ""
#: tfrmoptionstoolbar.lblhotkey.caption
msgid "Hot key:"
msgstr ""
#: tfrmoptionstoolbar.lbliconfile.caption
msgid "Ico&n:"
msgstr ""
#: tfrmoptionstoolbar.lbliconsize.caption
msgid "Icon si&ze:"
msgstr ""
#: tfrmoptionstoolbar.lblinternalcommand.caption
msgid "Co&mmand:"
msgstr ""
#: tfrmoptionstoolbar.lblinternalparameters.caption
msgid "&Parameters:"
msgstr ""
#: tfrmoptionstoolbar.lblstartpath.caption
msgctxt "TFRMOPTIONSTOOLBAR.LBLSTARTPATH.CAPTION"
msgid "Start pat&h:"
msgstr ""
#: tfrmoptionstoolbar.lbltooltip.caption
msgid "&Tooltip:"
msgstr ""
#: tfrmoptionstoolbar.miaddallcmds.caption
msgid "Add toolbar with ALL DC commands"
msgstr ""
#: tfrmoptionstoolbar.miaddexternalcommandsubmenu.caption
msgid "for an external command"
msgstr ""
#: tfrmoptionstoolbar.miaddinternalcommandsubmenu.caption
msgid "for an internal command"
msgstr ""
#: tfrmoptionstoolbar.miaddseparatorsubmenu.caption
msgid "for a separator"
msgstr ""
#: tfrmoptionstoolbar.miaddsubtoolbarsubmenu.caption
msgid "for a sub-tool bar"
msgstr ""
#: tfrmoptionstoolbar.mibackup.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIBACKUP.CAPTION"
msgid "Backup..."
msgstr ""
#: tfrmoptionstoolbar.miexport.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORT.CAPTION"
msgid "Export..."
msgstr ""
#: tfrmoptionstoolbar.miexportcurrent.caption
msgid "Current toolbar..."
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttodcbar.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTODCBAR.CAPTION"
msgid "to a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcbarkeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARKEEP.CAPTION"
msgid "to a TC .BAR file (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcbarnokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCBARNOKEEP.CAPTION"
msgid "to a TC .BAR file (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportcurrenttotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTCURRENTTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexportseparator1.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR1.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miexportseparator2.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR2.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miexportseparator3.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR3.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miexportseparator4.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTSEPARATOR4.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miexporttop.caption
msgid "Top toolbar..."
msgstr ""
#: tfrmoptionstoolbar.miexporttoptobackup.caption
msgid "Save a backup of Toolbar"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptodcbar.caption
msgctxt "tfrmoptionstoolbar.miexporttoptodcbar.caption"
msgid "to a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcbarkeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarkeep.caption"
msgid "to a TC .BAR file (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption
msgctxt "tfrmoptionstoolbar.miexporttoptotcbarnokeep.caption"
msgid "to a TC .BAR file (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcinikeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCINIKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (keep existing)"
msgstr ""
#: tfrmoptionstoolbar.miexporttoptotcininokeep.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXPORTTOPTOTCININOKEEP.CAPTION"
msgid "to a \"wincmd.ini\" of TC (erase existing)"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.miexternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIEXTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.miimport.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORT.CAPTION"
msgid "Import..."
msgstr ""
#: tfrmoptionstoolbar.miimportbackup.caption
msgid "Restore a backup of Toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportbackupreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTBACKUPREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbar.caption
msgid "from a Toolbar File (.toolbar)"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddcurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddcurrent.caption"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenucurrent.caption"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddmenutop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddmenutop.caption"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbaraddtop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbaraddtop.caption"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportdcbarreplacetop.caption
msgctxt "tfrmoptionstoolbar.miimportdcbarreplacetop.caption"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimportseparator.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTSEPARATOR.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbar.caption
msgid "from a single TC .BAR file"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbaraddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcbarreplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCBARREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcini.caption
msgid "from \"wincmd.ini\" of TC..."
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDCURRENT.CAPTION"
msgid "to add to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddmenucurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUCURRENT.CAPTION"
msgid "to add to a new toolbar to current toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddmenutop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDMENUTOP.CAPTION"
msgid "to add to a new toolbar to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttciniaddtop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIADDTOP.CAPTION"
msgid "to add to top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miimporttcinireplacetop.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIIMPORTTCINIREPLACETOP.CAPTION"
msgid "to replace top toolbar"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandaftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDLASTELEMENT.CAPTION"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.miinternalcommandpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MIINTERNALCOMMANDPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.misearchandreplace.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEARCHANDREPLACE.CAPTION"
msgid "Search and replace..."
msgstr ""
#: tfrmoptionstoolbar.miseparator1.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR1.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miseparator10.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR10.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miseparator11.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR11.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miseparator13.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR13.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miseparator14.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR14.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miseparator2.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR2.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miseparator6.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR6.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miseparator7.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR7.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miseparator8.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR8.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miseparator9.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISEPARATOR9.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.miseparatoraftercurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatoraftercurrent.caption"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.miseparatorfirstitem.caption
msgctxt "tfrmoptionstoolbar.miseparatorfirstitem.caption"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.miseparatorlastelement.caption
msgctxt "tfrmoptionstoolbar.miseparatorlastelement.caption"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.miseparatorpriorcurrent.caption
msgctxt "tfrmoptionstoolbar.miseparatorpriorcurrent.caption"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.misrcrplallofall.caption
msgid "in all of all the above..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplclickseparator.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISRCRPLCLICKSEPARATOR.CAPTION"
msgid "-"
msgstr ""
#: tfrmoptionstoolbar.misrcrplcommands.caption
msgid "in all commands..."
msgstr ""
#: tfrmoptionstoolbar.misrcrpliconnames.caption
msgid "in all icon names..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplparameters.caption
msgid "in all parameters..."
msgstr ""
#: tfrmoptionstoolbar.misrcrplstartpath.caption
msgid "in all start path..."
msgstr ""
#: tfrmoptionstoolbar.misubtoolbaraftercurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARAFTERCURRENT.CAPTION"
msgid "just after current selection"
msgstr ""
#: tfrmoptionstoolbar.misubtoolbarfirstelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARFIRSTELEMENT.CAPTION"
msgid "as first element"
msgstr ""
#: tfrmoptionstoolbar.misubtoolbarlastelement.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARLASTELEMENT.CAPTION"
msgid "as last element"
msgstr ""
#: tfrmoptionstoolbar.misubtoolbarpriorcurrent.caption
msgctxt "TFRMOPTIONSTOOLBAR.MISUBTOOLBARPRIORCURRENT.CAPTION"
msgid "just prior current selection"
msgstr ""
#: tfrmoptionstoolbar.rgtoolitemtype.caption
msgid "Button type"
msgstr ""
#: tfrmoptionstoolbase.btnrelativetoolpath.hint
msgctxt "TFRMOPTIONSTOOLBASE.BTNRELATIVETOOLPATH.HINT"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmoptionstoolbase.cbtoolskeepterminalopen.caption
msgid "&Keep terminal window open after executing program"
msgstr ""
#: tfrmoptionstoolbase.cbtoolsruninterminal.caption
msgid "&Execute in terminal"
msgstr ""
#: tfrmoptionstoolbase.cbtoolsuseexternalprogram.caption
msgid "&Use external program"
msgstr ""
#: tfrmoptionstoolbase.lbltoolsparameters.caption
msgid "A&dditional parameters"
msgstr ""
#: tfrmoptionstoolbase.lbltoolspath.caption
msgid "&Path to program to execute"
msgstr ""
#: tfrmoptionstooltips.btnaddfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNADDFIELDS.CAPTION"
msgid "A&dd"
msgstr ""
#: tfrmoptionstooltips.btnapplyfields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNAPPLYFIELDS.CAPTION"
msgid "A&pply"
msgstr ""
#: tfrmoptionstooltips.btndeletefields.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNDELETEFIELDS.CAPTION"
msgid "D&elete"
msgstr ""
#: tfrmoptionstooltips.btnfieldslist.caption
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSLIST.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstooltips.btnfieldssearchtemplate.hint
msgctxt "TFRMOPTIONSTOOLTIPS.BTNFIELDSSEARCHTEMPLATE.HINT"
msgid "Template..."
msgstr ""
#: tfrmoptionstooltips.chkshowtooltip.caption
msgid "&Show tooltip for files in the file panel"
msgstr ""
#: tfrmoptionstooltips.gbcustomfields.caption
msgid "Custom fields by file type"
msgstr ""
#: tfrmoptionstooltips.lblfieldslist.caption
msgid "Category &hint:"
msgstr ""
#: tfrmoptionstooltips.lblfieldsmask.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSMASK.CAPTION"
msgid "Category &mask:"
msgstr ""
#: tfrmoptionstooltips.lblfieldsname.caption
msgctxt "TFRMOPTIONSTOOLTIPS.LBLFIELDSNAME.CAPTION"
msgid "Category &name:"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfromdoubleclick.caption
msgid "With double-click on the bar on top of a file panel"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption
msgctxt "tfrmoptionstreeviewmenu.ckbdirectoryhotlistfrommenucommand.caption"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbdoubleclickselect.caption
msgid "Double click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritatabsfrommenucommand.caption
msgctxt "TFRMOPTIONSTREEVIEWMENU.CKBFAVORITATABSFROMMENUCOMMAND.CAPTION"
msgid "With the menu and internal command"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbfavoritetabsfromdoubleclick.caption
msgid "With double-click on a tab (if configured for it)"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbshortcutselectandclose.caption
msgid "When using the keyboard shortcut, it will exit the window returning the current choice"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbsingleclickselect.caption
msgid "Single mouse click in tree select and exit"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforcommandlinehistory.caption
msgid "Use it for Command Line History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbusefordirhistory.caption
msgid "Use it for the Dir History"
msgstr ""
#: tfrmoptionstreeviewmenu.ckbuseforviewhistory.caption
msgid "Use it for the View History (Visited paths for active view)"
msgstr ""
#: tfrmoptionstreeviewmenu.gbbehavior.caption
msgid "Behavior regarding selection:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbtreeviewmenusettings.caption
msgid "Tree View Menus related options:"
msgstr ""
#: tfrmoptionstreeviewmenu.gbwheretousetreeviewmenu.caption
msgid "Where to use Tree View Menus:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblnote.caption
msgid "*NOTE: Regarding the options like the case sensitivity, ignoring accents or not, these are saved and restored individually for each context from a usage and session to another."
msgstr ""
#: tfrmoptionstreeviewmenu.lbluseindirectoryhotlist.caption
msgid "With Directory Hotlist:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithfavoritetabs.caption
msgid "With Favorite Tabs:"
msgstr ""
#: tfrmoptionstreeviewmenu.lblusewithhistory.caption
msgid "With History:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnbackgroundcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNBACKGROUNDCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btncursorcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNCURSORCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnfoundtextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnfoundtextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNFOUNDTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnnormaltextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnnormaltextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNNORMALTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnsecondarytextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnsecondarytextundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSECONDARYTEXTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnshortcutcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnshortcutundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNSHORTCUTUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnunselectabletextcolor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLETEXTCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstreeviewmenucolor.btnunselectableundercursor.caption
msgctxt "TFRMOPTIONSTREEVIEWMENUCOLOR.BTNUNSELECTABLEUNDERCURSOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionstreeviewmenucolor.cbkusagekeyboardshortcut.caption
msgid "Use and display keyboard shortcut for choosing items"
msgstr ""
#: tfrmoptionstreeviewmenucolor.gblayoutandcolors.caption
msgid "Layout and colors options:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblbackgroundcolor.caption
msgid "Background color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblcursorcolor.caption
msgid "Cursor color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblfoundtextcolor.caption
msgid "Found text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblfoundtextundercursor.caption
msgid "Found text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblnormaltextcolor.caption
msgid "Normal text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblnormaltextundercursor.caption
msgid "Normal text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblpreview.caption
msgid "Tree View Menu Preview:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextcolor.caption
msgid "Secondary text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblsecondarytextundercursor.caption
msgid "Secondary text under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutcolor.caption
msgid "Shortcut color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblshortcutundercursor.caption
msgid "Shortcut under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectabletextcolor.caption
msgid "Unselectable text color:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.lblunselectableundercursor.caption
msgid "Unselectable under cursor:"
msgstr ""
#: tfrmoptionstreeviewmenucolor.treeviewmenusample.hint
msgid "Change color on left and you'll see here a preview of what your Tree View Menus will look likes with this sample."
msgstr ""
#: tfrmoptionsviewer.btnbackviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNBACKVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsviewer.btnfontviewercolor.caption
msgctxt "TFRMOPTIONSVIEWER.BTNFONTVIEWERCOLOR.CAPTION"
msgid ">>"
msgstr ""
#: tfrmoptionsviewer.gbviewerbookmode.caption
msgid "Viewer Book Mode"
msgstr ""
#: tfrmoptionsviewer.gbviewerexample.caption
msgid "Example"
msgstr ""
#: tfrmoptionsviewer.lblbackgroundcolorviewerbook.caption
msgid "&Background color in book viewer"
msgstr ""
#: tfrmoptionsviewer.lblfontcolorviewerbook.caption
msgid "&Font color in book viewer"
msgstr ""
#: tfrmoptionsviewer.lblnumbercolumnsviewer.caption
msgid "&Number of columns in book viewer"
msgstr ""
#: tfrmpackdlg.btnconfig.caption
msgctxt "tfrmpackdlg.btnconfig.caption"
msgid "Con&figure"
msgstr ""
#: tfrmpackdlg.caption
msgid "Pack files"
msgstr ""
#: tfrmpackdlg.cbcreateseparatearchives.caption
msgid "C&reate separate archives, one per selected file/dir"
msgstr ""
#: tfrmpackdlg.cbcreatesfx.caption
msgid "Create self e&xtracting archive"
msgstr ""
#: tfrmpackdlg.cbencrypt.caption
msgid "Encr&ypt"
msgstr ""
#: tfrmpackdlg.cbmovetoarchive.caption
msgid "Mo&ve to archive"
msgstr ""
#: tfrmpackdlg.cbmultivolume.caption
msgid "&Multiple disk archive"
msgstr ""
#: tfrmpackdlg.cbotherplugins.caption
msgid "=>"
msgstr ""
#: tfrmpackdlg.cbputintarfirst.caption
msgid "P&ut in the TAR archive first"
msgstr ""
#: tfrmpackdlg.cbstoredir.caption
msgid "Also &pack path names (only recursed)"
msgstr ""
#: tfrmpackdlg.lblprompt.caption
msgid "Pack file(s) to the file:"
msgstr ""
#: tfrmpackdlg.rgpacker.caption
msgid "Packer"
msgstr ""
#: tfrmpackinfodlg.btnclose.caption
msgctxt "TFRMPACKINFODLG.BTNCLOSE.CAPTION"
msgid "&Close"
msgstr ""
#: tfrmpackinfodlg.btnunpackallandexec.caption
msgid "Unpack &all and execute"
msgstr ""
#: tfrmpackinfodlg.btnunpackandexec.caption
msgid "&Unpack and execute"
msgstr ""
#: tfrmpackinfodlg.caption
msgid "Properties of packed file"
msgstr ""
#: tfrmpackinfodlg.lblattributes.caption
msgid "Attributes:"
msgstr ""
#: tfrmpackinfodlg.lblcompressionratio.caption
msgid "Compression ratio:"
msgstr ""
#: tfrmpackinfodlg.lbldate.caption
msgid "Date:"
msgstr ""
#: tfrmpackinfodlg.lblmethod.caption
msgid "Method:"
msgstr ""
#: tfrmpackinfodlg.lbloriginalsize.caption
msgid "Original size:"
msgstr ""
#: tfrmpackinfodlg.lblpackedfile.caption
msgid "File:"
msgstr ""
#: tfrmpackinfodlg.lblpackedsize.caption
msgid "Packed size:"
msgstr ""
#: tfrmpackinfodlg.lblpacker.caption
msgid "Packer:"
msgstr ""
#: tfrmpackinfodlg.lbltime.caption
msgid "Time:"
msgstr ""
#: tfrmquicksearch.btncancel.caption
msgctxt "TFRMQUICKSEARCH.BTNCANCEL.CAPTION"
msgid "X"
msgstr ""
#: tfrmquicksearch.btncancel.hint
msgid "Close filter panel"
msgstr ""
#: tfrmquicksearch.edtsearch.hint
msgid "Enter text to search for or filter by"
msgstr ""
#: tfrmquicksearch.sbcasesensitive.caption
msgid "Aa"
msgstr ""
#: tfrmquicksearch.sbcasesensitive.hint
msgid "Case Sensitive"
msgstr ""
#: tfrmquicksearch.sbdirectories.caption
msgid "D"
msgstr ""
#: tfrmquicksearch.sbdirectories.hint
msgctxt "TFRMQUICKSEARCH.SBDIRECTORIES.HINT"
msgid "Directories"
msgstr ""
#: tfrmquicksearch.sbfiles.caption
msgid "F"
msgstr ""
#: tfrmquicksearch.sbfiles.hint
msgctxt "TFRMQUICKSEARCH.SBFILES.HINT"
msgid "Files"
msgstr ""
#: tfrmquicksearch.sbmatchbeginning.caption
msgid "{"
msgstr ""
#: tfrmquicksearch.sbmatchbeginning.hint
msgid "Match Beginning"
msgstr ""
#: tfrmquicksearch.sbmatchending.caption
msgid "}"
msgstr ""
#: tfrmquicksearch.sbmatchending.hint
msgid "Match Ending"
msgstr ""
#: tfrmquicksearch.tglfilter.caption
msgid "Filter"
msgstr ""
#: tfrmquicksearch.tglfilter.hint
msgid "Toggle between search or filter"
msgstr ""
#: tfrmsearchplugin.btnadd.caption
msgid "&More rules"
msgstr ""
#: tfrmsearchplugin.btndelete.caption
msgid "L&ess rules"
msgstr ""
#: tfrmsearchplugin.chkuseplugins.caption
msgid "Use &content plugins, combine with:"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[0].text
msgctxt "TFRMSEARCHPLUGIN.HEADERCONTROL.SECTIONS[0].TEXT"
msgid "Plugin"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[1].text
msgid "Field"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[2].text
msgid "Operator"
msgstr ""
#: tfrmsearchplugin.headercontrol.sections[3].text
msgctxt "tfrmsearchplugin.headercontrol.sections[3].text"
msgid "Value"
msgstr ""
#: tfrmsearchplugin.rband.caption
msgid "&AND (all match)"
msgstr ""
#: tfrmsearchplugin.rbor.caption
msgid "&OR (any match)"
msgstr ""
#: tfrmselecttextrange.btppanel.cancelbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CANCELBUTTON.CAPTION"
msgid "Cancel"
msgstr ""
#: tfrmselecttextrange.btppanel.closebutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.CLOSEBUTTON.CAPTION"
msgid "&Close"
msgstr ""
#: tfrmselecttextrange.btppanel.helpbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.HELPBUTTON.CAPTION"
msgid "&Help"
msgstr ""
#: tfrmselecttextrange.btppanel.okbutton.caption
msgctxt "TFRMSELECTTEXTRANGE.BTPPANEL.OKBUTTON.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmselecttextrange.lblselecttext.caption
msgid "&Select the characters to insert:"
msgstr ""
#: tfrmsetfileproperties.btncancel.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmsetfileproperties.btnok.caption
msgctxt "TFRMSETFILEPROPERTIES.BTNOK.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmsetfileproperties.caption
msgid "Change attributes"
msgstr ""
#: tfrmsetfileproperties.cbsgid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSGID.CAPTION"
msgid "SGID"
msgstr ""
#: tfrmsetfileproperties.cbsticky.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSTICKY.CAPTION"
msgid "Sticky"
msgstr ""
#: tfrmsetfileproperties.cbsuid.caption
msgctxt "TFRMSETFILEPROPERTIES.CBSUID.CAPTION"
msgid "SUID"
msgstr ""
#: tfrmsetfileproperties.chkarchive.caption
msgid "Archive"
msgstr ""
#: tfrmsetfileproperties.chkcreationtime.caption
msgid "Created:"
msgstr ""
#: tfrmsetfileproperties.chkhidden.caption
msgid "Hidden"
msgstr ""
#: tfrmsetfileproperties.chklastaccesstime.caption
msgid "Accessed:"
msgstr ""
#: tfrmsetfileproperties.chklastwritetime.caption
msgid "Modified:"
msgstr ""
#: tfrmsetfileproperties.chkreadonly.caption
msgid "Read only"
msgstr ""
#: tfrmsetfileproperties.chkrecursive.caption
msgid "Including subfolders"
msgstr ""
#: tfrmsetfileproperties.chksystem.caption
msgid "System"
msgstr ""
#: tfrmsetfileproperties.gbtimesamp.caption
msgid "Timestamp properties"
msgstr ""
#: tfrmsetfileproperties.gbunixattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBUNIXATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr ""
#: tfrmsetfileproperties.gbwinattributes.caption
msgctxt "TFRMSETFILEPROPERTIES.GBWINATTRIBUTES.CAPTION"
msgid "Attributes"
msgstr ""
#: tfrmsetfileproperties.lblattrbitsstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRBITSSTR.CAPTION"
msgid "Bits:"
msgstr ""
#: tfrmsetfileproperties.lblattrgroupstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRGROUPSTR.CAPTION"
msgid "Group"
msgstr ""
#: tfrmsetfileproperties.lblattrinfo.caption
msgctxt "tfrmsetfileproperties.lblattrinfo.caption"
msgid "(gray field means unchanged value)"
msgstr ""
#: tfrmsetfileproperties.lblattrotherstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROTHERSTR.CAPTION"
msgid "Other"
msgstr ""
#: tfrmsetfileproperties.lblattrownerstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTROWNERSTR.CAPTION"
msgid "Owner"
msgstr ""
#: tfrmsetfileproperties.lblattrtext.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXT.CAPTION"
msgid "-----------"
msgstr ""
#: tfrmsetfileproperties.lblattrtextstr.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLATTRTEXTSTR.CAPTION"
msgid "Text:"
msgstr ""
#: tfrmsetfileproperties.lblexec.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLEXEC.CAPTION"
msgid "Execute"
msgstr ""
#: tfrmsetfileproperties.lblmodeinfo.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLMODEINFO.CAPTION"
msgid "(gray field means unchanged value)"
msgstr ""
#: tfrmsetfileproperties.lbloctal.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLOCTAL.CAPTION"
msgid "Octal:"
msgstr ""
#: tfrmsetfileproperties.lblread.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLREAD.CAPTION"
msgid "Read"
msgstr ""
#: tfrmsetfileproperties.lblwrite.caption
msgctxt "TFRMSETFILEPROPERTIES.LBLWRITE.CAPTION"
msgid "Write"
msgstr ""
#: tfrmsplitter.btncancel.caption
msgctxt "TFRMSPLITTER.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmsplitter.btnftchoice.caption
msgctxt "TFRMSPLITTER.BTNFTCHOICE.CAPTION"
msgid "..."
msgstr ""
#: tfrmsplitter.btnok.caption
msgctxt "TFRMSPLITTER.BTNOK.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmsplitter.btnrelativeftchoice.hint
msgctxt "TFRMSPLITTER.BTNRELATIVEFTCHOICE.HINT"
msgid "Some functions to select appropriate path"
msgstr ""
#: tfrmsplitter.caption
msgid "Splitter"
msgstr ""
#: tfrmsplitter.cbrequireacrc32verificationfile.caption
msgid "Require a CRC32 verification file"
msgstr ""
#: tfrmsplitter.cmbxsize.text
msgid "1457664B - 3.5\""
msgstr ""
#: tfrmsplitter.grbxfile.caption
msgctxt "TFRMSPLITTER.GRBXFILE.CAPTION"
msgid "File name"
msgstr ""
#: tfrmsplitter.grbxsize.caption
msgid "Size and number of parts"
msgstr ""
#: tfrmsplitter.lbdirtarget.caption
msgid "Directory &target"
msgstr ""
#: tfrmsplitter.lbfilesource.caption
msgid "File &source"
msgstr ""
#: tfrmsplitter.lblnumberparts.caption
msgid "&Number of parts"
msgstr ""
#: tfrmsplitter.rbtnbyte.caption
msgid "&Bytes"
msgstr ""
#: tfrmsplitter.rbtngigab.caption
msgid "&Gigabytes"
msgstr ""
#: tfrmsplitter.rbtnkilob.caption
msgid "&Kilobytes"
msgstr ""
#: tfrmsplitter.rbtnmegab.caption
msgid "&Megabytes"
msgstr ""
#: tfrmstartingsplash.caption
msgctxt "TFRMSTARTINGSPLASH.CAPTION"
msgid "Double Commander"
msgstr ""
#: tfrmstartingsplash.lblbuild.caption
msgctxt "TFRMSTARTINGSPLASH.LBLBUILD.CAPTION"
msgid "Build"
msgstr ""
#: tfrmstartingsplash.lblfreepascalver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLFREEPASCALVER.CAPTION"
msgid "Free Pascal"
msgstr ""
#: tfrmstartingsplash.lbllazarusver.caption
msgctxt "TFRMSTARTINGSPLASH.LBLLAZARUSVER.CAPTION"
msgid "Lazarus"
msgstr ""
#: tfrmstartingsplash.lbloperatingsystem.caption
msgid "Operating System"
msgstr ""
#: tfrmstartingsplash.lblplatform.caption
msgid "Platform"
msgstr ""
#: tfrmstartingsplash.lblrevision.caption
msgctxt "TFRMSTARTINGSPLASH.LBLREVISION.CAPTION"
msgid "Revision"
msgstr ""
#: tfrmstartingsplash.lbltitle.caption
msgctxt "TFRMSTARTINGSPLASH.LBLTITLE.CAPTION"
msgid "Double Commander"
msgstr ""
#: tfrmstartingsplash.lblversion.caption
msgctxt "TFRMSTARTINGSPLASH.LBLVERSION.CAPTION"
msgid "Version"
msgstr ""
#: tfrmstartingsplash.lblwidgetsetver.caption
msgid "WidgetsetVer"
msgstr ""
#: tfrmsymlink.btncancel.caption
msgctxt "TFRMSYMLINK.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmsymlink.btnok.caption
msgctxt "TFRMSYMLINK.BTNOK.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmsymlink.caption
msgid "Create symbolic link"
msgstr ""
#: tfrmsymlink.lblexistingfile.caption
msgctxt "TFRMSYMLINK.LBLEXISTINGFILE.CAPTION"
msgid "&Destination that the link will point to"
msgstr ""
#: tfrmsymlink.lbllinktocreate.caption
msgctxt "TFRMSYMLINK.LBLLINKTOCREATE.CAPTION"
msgid "&Link name"
msgstr ""
#: tfrmsyncdirsdlg.btnclose.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCLOSE.CAPTION"
msgid "Close"
msgstr ""
#: tfrmsyncdirsdlg.btncompare.caption
msgctxt "TFRMSYNCDIRSDLG.BTNCOMPARE.CAPTION"
msgid "Compare"
msgstr ""
#: tfrmsyncdirsdlg.btnseldir1.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR1.CAPTION"
msgid ">>"
msgstr ""
#: tfrmsyncdirsdlg.btnseldir2.caption
msgctxt "TFRMSYNCDIRSDLG.BTNSELDIR2.CAPTION"
msgid ">>"
msgstr ""
#: tfrmsyncdirsdlg.btnsynchronize.caption
msgctxt "tfrmsyncdirsdlg.btnsynchronize.caption"
msgid "Synchronize"
msgstr ""
#: tfrmsyncdirsdlg.caption
msgid "Synchronize directories"
msgstr ""
#: tfrmsyncdirsdlg.cbextfilter.text
msgctxt "TFRMSYNCDIRSDLG.CBEXTFILTER.TEXT"
msgid "*.*"
msgstr ""
#: tfrmsyncdirsdlg.chkasymmetric.caption
msgid "asymmetric"
msgstr ""
#: tfrmsyncdirsdlg.chkbycontent.caption
msgid "by content"
msgstr ""
#: tfrmsyncdirsdlg.chkignoredate.caption
msgid "ignore date"
msgstr ""
#: tfrmsyncdirsdlg.chkonlyselected.caption
msgid "only selected"
msgstr ""
#: tfrmsyncdirsdlg.chksubdirs.caption
msgid "Subdirs"
msgstr ""
#: tfrmsyncdirsdlg.groupbox1.caption
msgid "Show:"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[0].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[0].TITLE.CAPTION"
msgid "Name"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[1].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[1].TITLE.CAPTION"
msgid "Size"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[2].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[2].TITLE.CAPTION"
msgid "Date"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[3].title.caption
msgid "<=>"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[4].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[4].TITLE.CAPTION"
msgid "Date"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[5].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[5].TITLE.CAPTION"
msgid "Size"
msgstr ""
#: tfrmsyncdirsdlg.headerdg.columns[6].title.caption
msgctxt "TFRMSYNCDIRSDLG.HEADERDG.COLUMNS[6].TITLE.CAPTION"
msgid "Name"
msgstr ""
#: tfrmsyncdirsdlg.label1.caption
msgid "(in main window)"
msgstr ""
#: tfrmsyncdirsdlg.menuitemcompare.caption
msgctxt "TFRMSYNCDIRSDLG.MENUITEMCOMPARE.CAPTION"
msgid "Compare"
msgstr ""
#: tfrmsyncdirsdlg.menuitemviewleft.caption
msgid "View left"
msgstr ""
#: tfrmsyncdirsdlg.menuitemviewright.caption
msgid "View right"
msgstr ""
#: tfrmsyncdirsdlg.sbcopyleft.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYLEFT.CAPTION"
msgid "<"
msgstr ""
#: tfrmsyncdirsdlg.sbcopyright.caption
msgctxt "TFRMSYNCDIRSDLG.SBCOPYRIGHT.CAPTION"
msgid ">"
msgstr ""
#: tfrmsyncdirsdlg.sbduplicates.caption
msgid "duplicates"
msgstr ""
#: tfrmsyncdirsdlg.sbequal.caption
msgid "="
msgstr ""
#: tfrmsyncdirsdlg.sbnotequal.caption
msgid "!="
msgstr ""
#: tfrmsyncdirsdlg.sbsingles.caption
msgid "singles"
msgstr ""
#: tfrmsyncdirsdlg.statusbar1.panels[0].text
msgid "Please press \"Compare\" to start"
msgstr ""
#: tfrmsyncdirsperformdlg.caption
msgctxt "TFRMSYNCDIRSPERFORMDLG.CAPTION"
msgid "Synchronize"
msgstr ""
#: tfrmsyncdirsperformdlg.chkconfirmoverwrites.caption
msgid "Confirm overwrites"
msgstr ""
#: tfrmtreeviewmenu.caption
msgctxt "tfrmtreeviewmenu.caption"
msgid "Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.lblsearchingentry.caption
msgid "Select your hot directory:"
msgstr ""
#: tfrmtreeviewmenu.pmicasesensitive.caption
msgid "Search is case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pmifullcollapse.caption
msgid "Full collapse"
msgstr ""
#: tfrmtreeviewmenu.pmifullexpand.caption
msgid "Full expand"
msgstr ""
#: tfrmtreeviewmenu.pmiignoreaccents.caption
msgid "Search ignore accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotcasesensitive.caption
msgid "Search is not case sensitive"
msgstr ""
#: tfrmtreeviewmenu.pminotignoreaccents.caption
msgid "Search is strict regarding accents and ligatures"
msgstr ""
#: tfrmtreeviewmenu.pminotshowwholebranchifmatch.caption
msgid "Don't show the branch content \"just\" because the searched string is found in the branche name"
msgstr ""
#: tfrmtreeviewmenu.pmishowwholebranchifmatch.caption
msgid "If searched string is found in a branch name, show the whole branch even if elements don't match"
msgstr ""
#: tfrmtreeviewmenu.tbcancelandquit.hint
msgid "Close Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenus.hint
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUS.HINT"
msgid "Configuration of Tree View Menu"
msgstr ""
#: tfrmtreeviewmenu.tbconfigurationtreeviewmenuscolors.hint
msgctxt "TFRMTREEVIEWMENU.TBCONFIGURATIONTREEVIEWMENUSCOLORS.HINT"
msgid "Configuration of Tree View Menu Colors"
msgstr ""
#: tfrmtweakplugin.btnadd.caption
msgid "A&dd new"
msgstr ""
#: tfrmtweakplugin.btncancel.caption
msgctxt "TFRMTWEAKPLUGIN.BTNCANCEL.CAPTION"
msgid "&Cancel"
msgstr ""
#: tfrmtweakplugin.btnchange.caption
msgid "C&hange"
msgstr ""
#: tfrmtweakplugin.btndefault.caption
msgid "De&fault"
msgstr ""
#: tfrmtweakplugin.btnok.caption
msgctxt "TFRMTWEAKPLUGIN.BTNOK.CAPTION"
msgid "&OK"
msgstr ""
#: tfrmtweakplugin.btnremove.caption
msgctxt "TFRMTWEAKPLUGIN.BTNREMOVE.CAPTION"
msgid "&Remove"
msgstr ""
#: tfrmtweakplugin.caption
msgid "Tweak plugin"
msgstr ""
#: tfrmtweakplugin.cbpk_caps_by_content.caption
msgid "De&tect archive type by content"
msgstr ""
#: tfrmtweakplugin.cbpk_caps_delete.caption
msgid "Can de&lete files"
msgstr ""
#: tfrmtweakplugin.cbpk_caps_encrypt.caption
msgid "Supports e&ncryption"
msgstr ""
#: tfrmtweakplugin.cbpk_caps_hide.caption
msgid "Sho&w as normal files (hide packer icon)"
msgstr ""
#: tfrmtweakplugin.cbpk_caps_mempack.caption
msgid "Supports pac&king in memory"
msgstr ""
#: tfrmtweakplugin.cbpk_caps_modify.caption
msgid "Can &modify existing archives"
msgstr ""
#: tfrmtweakplugin.cbpk_caps_multiple.caption
msgid "&Archive can contain multiple files"
msgstr ""
#: tfrmtweakplugin.cbpk_caps_new.caption
msgid "Can create new archi&ves"
msgstr ""
#: tfrmtweakplugin.cbpk_caps_options.caption
msgid "S&upports the options dialogbox"
msgstr ""
#: tfrmtweakplugin.cbpk_caps_searchtext.caption
msgid "Allow searchin&g for text in archives"
msgstr ""
#: tfrmtweakplugin.lbldescription.caption
msgid "&Description:"
msgstr ""
#: tfrmtweakplugin.lbldetectstr.caption
msgid "D&etect string:"
msgstr ""
#: tfrmtweakplugin.lblextension.caption
msgid "&Extension:"
msgstr ""
#: tfrmtweakplugin.lblflags.caption
msgid "Flags:"
msgstr ""
#: tfrmtweakplugin.lblname.caption
msgid "&Name:"
msgstr ""
#: tfrmtweakplugin.lblplugin.caption
msgctxt "tfrmtweakplugin.lblplugin.caption"
msgid "&Plugin:"
msgstr ""
#: tfrmtweakplugin.lblplugin1.caption
msgctxt "TFRMTWEAKPLUGIN.LBLPLUGIN1.CAPTION"
msgid "&Plugin:"
msgstr ""
#: tfrmviewer.actabout.caption
msgid "About Viewer..."
msgstr ""
#: tfrmviewer.actabout.hint
msgid "Displays the About message"
msgstr ""
#: tfrmviewer.actcopyfile.caption
msgctxt "tfrmviewer.actcopyfile.caption"
msgid "Copy File"
msgstr ""
#: tfrmviewer.actcopyfile.hint
msgctxt "TFRMVIEWER.ACTCOPYFILE.HINT"
msgid "Copy File"
msgstr ""
#: tfrmviewer.actcopytoclipboard.caption
msgctxt "TFRMVIEWER.ACTCOPYTOCLIPBOARD.CAPTION"
msgid "Copy To Clipboard"
msgstr ""
#: tfrmviewer.actcopytoclipboardformatted.caption
msgid "Copy To Clipboard Formatted"
msgstr ""
#: tfrmviewer.actdeletefile.caption
msgctxt "tfrmviewer.actdeletefile.caption"
msgid "Delete File"
msgstr ""
#: tfrmviewer.actdeletefile.hint
msgctxt "TFRMVIEWER.ACTDELETEFILE.HINT"
msgid "Delete File"
msgstr ""
#: tfrmviewer.actexitviewer.caption
msgctxt "TFRMVIEWER.ACTEXITVIEWER.CAPTION"
msgid "E&xit"
msgstr ""
#: tfrmviewer.actfind.caption
msgctxt "TFRMVIEWER.ACTFIND.CAPTION"
msgid "Find"
msgstr ""
#: tfrmviewer.actfindnext.caption
msgctxt "TFRMVIEWER.ACTFINDNEXT.CAPTION"
msgid "Find next"
msgstr ""
#: tfrmviewer.actfindprev.caption
msgctxt "TFRMVIEWER.ACTFINDPREV.CAPTION"
msgid "Find previous"
msgstr ""
#: tfrmviewer.actfullscreen.caption
msgctxt "TFRMVIEWER.ACTFULLSCREEN.CAPTION"
msgid "Full Screen"
msgstr ""
#: tfrmviewer.actimagecenter.caption
msgid "Center"
msgstr ""
#: tfrmviewer.actloadnextfile.caption
msgid "&Next"
msgstr ""
#: tfrmviewer.actloadnextfile.hint
msgid "Load Next File"
msgstr ""
#: tfrmviewer.actloadprevfile.caption
msgid "&Previous"
msgstr ""
#: tfrmviewer.actloadprevfile.hint
msgid "Load Previous File"
msgstr ""
#: tfrmviewer.actmirrorhorz.caption
msgid "Mirror Horizontally"
msgstr ""
#: tfrmviewer.actmirrorhorz.hint
msgid "Mirror"
msgstr ""
#: tfrmviewer.actmirrorvert.caption
msgid "Mirror Vertically"
msgstr ""
#: tfrmviewer.actmovefile.caption
msgctxt "tfrmviewer.actmovefile.caption"
msgid "Move File"
msgstr ""
#: tfrmviewer.actmovefile.hint
msgctxt "TFRMVIEWER.ACTMOVEFILE.HINT"
msgid "Move File"
msgstr ""
#: tfrmviewer.actpreview.caption
msgctxt "tfrmviewer.actpreview.caption"
msgid "Preview"
msgstr ""
#: tfrmviewer.actreload.caption
msgctxt "TFRMVIEWER.ACTRELOAD.CAPTION"
msgid "Reload"
msgstr ""
#: tfrmviewer.actreload.hint
msgid "Reload current file"
msgstr ""
#: tfrmviewer.actrotate180.caption
msgid "+ 180"
msgstr ""
#: tfrmviewer.actrotate180.hint
msgid "Rotate 180 degrees"
msgstr ""
#: tfrmviewer.actrotate270.caption
msgid "- 90"
msgstr ""
#: tfrmviewer.actrotate270.hint
msgid "Rotate -90 degrees"
msgstr ""
#: tfrmviewer.actrotate90.caption
msgid "+ 90"
msgstr ""
#: tfrmviewer.actrotate90.hint
msgid "Rotate +90 degrees"
msgstr ""
#: tfrmviewer.actsave.caption
msgctxt "TFRMVIEWER.ACTSAVE.CAPTION"
msgid "Save"
msgstr ""
#: tfrmviewer.actsaveas.caption
msgid "Save As..."
msgstr ""
#: tfrmviewer.actsaveas.hint
msgid "Save File As..."
msgstr ""
#: tfrmviewer.actscreenshot.caption
msgctxt "TFRMVIEWER.ACTSCREENSHOT.CAPTION"
msgid "Screenshot"
msgstr ""
#: tfrmviewer.actscreenshotdelay3sec.caption
msgid "Delay 3 sec"
msgstr ""
#: tfrmviewer.actscreenshotdelay5sec.caption
msgid "Delay 5 sec"
msgstr ""
#: tfrmviewer.actselectall.caption
msgctxt "TFRMVIEWER.ACTSELECTALL.CAPTION"
msgid "Select All"
msgstr ""
#: tfrmviewer.actshowasbin.caption
msgid "Show as &Bin"
msgstr ""
#: tfrmviewer.actshowasbook.caption
msgid "Show as B&ook"
msgstr ""
#: tfrmviewer.actshowasdec.caption
msgid "Show as &Dec"
msgstr ""
#: tfrmviewer.actshowashex.caption
msgid "Show as &Hex"
msgstr ""
#: tfrmviewer.actshowastext.caption
msgid "Show as &Text"
msgstr ""
#: tfrmviewer.actshowaswraptext.caption
msgid "Show as &Wrap text"
msgstr ""
#: tfrmviewer.actshowgraphics.caption
msgid "Graphics"
msgstr ""
#: tfrmviewer.actshowplugins.caption
msgctxt "TFRMVIEWER.ACTSHOWPLUGINS.CAPTION"
msgid "Plugins"
msgstr ""
#: tfrmviewer.actstretchimage.caption
msgid "Stretch"
msgstr ""
#: tfrmviewer.actstretchimage.hint
msgid "Stretch Image"
msgstr ""
#: tfrmviewer.actstretchonlylarge.caption
msgid "Stretch only large"
msgstr ""
#: tfrmviewer.actzoom.caption
msgid "Zoom"
msgstr ""
#: tfrmviewer.actzoomin.caption
msgid "Zoom In"
msgstr ""
#: tfrmviewer.actzoomout.caption
msgid "Zoom Out"
msgstr ""
#: tfrmviewer.btncopyfile.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE.HINT"
msgid "Copy"
msgstr ""
#: tfrmviewer.btncopyfile1.hint
msgctxt "TFRMVIEWER.BTNCOPYFILE1.HINT"
msgid "Copy"
msgstr ""
#: tfrmviewer.btncuttuimage.hint
msgid "Crop"
msgstr ""
#: tfrmviewer.btndeletefile.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE.HINT"
msgid "Delete"
msgstr ""
#: tfrmviewer.btndeletefile1.hint
msgctxt "TFRMVIEWER.BTNDELETEFILE1.HINT"
msgid "Delete"
msgstr ""
#: tfrmviewer.btnfullscreen.hint
msgctxt "tfrmviewer.btnfullscreen.hint"
msgid "Full Screen"
msgstr ""
#: tfrmviewer.btngifmove.caption
msgctxt "TFRMVIEWER.BTNGIFMOVE.CAPTION"
msgid "||"
msgstr ""
#: tfrmviewer.btngiftobmp.caption
msgid "S"
msgstr ""
#: tfrmviewer.btnhightlight.hint
msgctxt "TFRMVIEWER.BTNHIGHTLIGHT.HINT"
msgid "Highlight"
msgstr ""
#: tfrmviewer.btnmovefile.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE.HINT"
msgid "Move"
msgstr ""
#: tfrmviewer.btnmovefile1.hint
msgctxt "TFRMVIEWER.BTNMOVEFILE1.HINT"
msgid "Move"
msgstr ""
#: tfrmviewer.btnnextgifframe.caption
msgid "||>"
msgstr ""
#: tfrmviewer.btnpaint.hint
msgctxt "TFRMVIEWER.BTNPAINT.HINT"
msgid "Paint"
msgstr ""
#: tfrmviewer.btnprevgifframe.caption
msgid "<||"
msgstr ""
#: tfrmviewer.btnredeye.hint
msgid "Red Eyes"
msgstr ""
#: tfrmviewer.btnresize.hint
msgid "Resize"
msgstr ""
#: tfrmviewer.btnundo.hint
msgctxt "TFRMVIEWER.BTNUNDO.HINT"
msgid "Undo"
msgstr ""
#: tfrmviewer.caption
msgctxt "tfrmviewer.caption"
msgid "Viewer"
msgstr ""
#: tfrmviewer.cbslideshow.caption
msgctxt "TFRMVIEWER.CBSLIDESHOW.CAPTION"
msgid "Slide Show"
msgstr ""
#: tfrmviewer.comboboxpaint.text
msgid "Pen"
msgstr ""
#: tfrmviewer.comboboxwidth.text
msgctxt "TFRMVIEWER.COMBOBOXWIDTH.TEXT"
msgid "1"
msgstr ""
#: tfrmviewer.gboxhightlight.caption
msgctxt "tfrmviewer.gboxhightlight.caption"
msgid "Highlight"
msgstr ""
#: tfrmviewer.gboxpaint.caption
msgctxt "tfrmviewer.gboxpaint.caption"
msgid "Paint"
msgstr ""
#: tfrmviewer.gboxslideshow.caption
msgctxt "tfrmviewer.gboxslideshow.caption"
msgid "Slide Show"
msgstr ""
#: tfrmviewer.gboxview.caption
msgctxt "TFRMVIEWER.GBOXVIEW.CAPTION"
msgid "View"
msgstr ""
#: tfrmviewer.lblhightlight.caption
msgid "0x0"
msgstr ""
#: tfrmviewer.miabout.caption
msgctxt "TFRMVIEWER.MIABOUT.CAPTION"
msgid "About"
msgstr ""
#: tfrmviewer.midiv1.caption
msgctxt "TFRMVIEWER.MIDIV1.CAPTION"
msgid "-"
msgstr ""
#: tfrmviewer.midiv2.caption
msgctxt "TFRMVIEWER.MIDIV2.CAPTION"
msgid "-"
msgstr ""
#: tfrmviewer.midiv3.caption
msgctxt "TFRMVIEWER.MIDIV3.CAPTION"
msgid "-"
msgstr ""
#: tfrmviewer.midiv4.caption
msgctxt "TFRMVIEWER.MIDIV4.CAPTION"
msgid "-"
msgstr ""
#: tfrmviewer.midiv5.caption
msgctxt "TFRMVIEWER.MIDIV5.CAPTION"
msgid "-"
msgstr ""
#: tfrmviewer.miedit.caption
msgctxt "TFRMVIEWER.MIEDIT.CAPTION"
msgid "&Edit"
msgstr ""
#: tfrmviewer.miencoding.caption
msgctxt "TFRMVIEWER.MIENCODING.CAPTION"
msgid "En&coding"
msgstr ""
#: tfrmviewer.mifile.caption
msgctxt "TFRMVIEWER.MIFILE.CAPTION"
msgid "&File"
msgstr ""
#: tfrmviewer.miimage.caption
msgid "&Image"
msgstr ""
#: tfrmviewer.miprint.caption
msgid "Print..."
msgstr ""
#: tfrmviewer.mirotate.caption
msgid "Rotate"
msgstr ""
#: tfrmviewer.miscreenshot.caption
msgctxt "tfrmviewer.miscreenshot.caption"
msgid "Screenshot"
msgstr ""
#: tfrmviewer.miseparator.caption
msgctxt "TFRMVIEWER.MISEPARATOR.CAPTION"
msgid "-"
msgstr ""
#: tfrmviewer.miview.caption
msgctxt "TFRMVIEWER.MIVIEW.CAPTION"
msgid "&View"
msgstr ""
#: tfrmviewer.pmiselectall.caption
msgctxt "TFRMVIEWER.PMISELECTALL.CAPTION"
msgid "Select All"
msgstr ""
#: tmultiarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "tmultiarchivecopyoperationoptionsui.lblfileexists.caption"
msgid "When file exists"
msgstr ""
#: twcxarchivecopyoperationoptionsui.lblfileexists.caption
msgctxt "TWCXARCHIVECOPYOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr ""
#: twfxplugincopymoveoperationoptionsui.cbcopytime.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.CBCOPYTIME.CAPTION"
msgid "Copy d&ate/time"
msgstr ""
#: twfxplugincopymoveoperationoptionsui.cbworkinbackground.caption
msgid "Work in background (separate connection)"
msgstr ""
#: twfxplugincopymoveoperationoptionsui.lblfileexists.caption
msgctxt "TWFXPLUGINCOPYMOVEOPERATIONOPTIONSUI.LBLFILEEXISTS.CAPTION"
msgid "When file exists"
msgstr ""
#: uexifreader.rsdatetimeoriginal
msgid "Date taken"
msgstr ""
#: uexifreader.rsimageheight
msgctxt "uexifreader.rsimageheight"
msgid "Height"
msgstr ""
#: uexifreader.rsimagewidth
msgctxt "uexifreader.rsimagewidth"
msgid "Width"
msgstr ""
#: uexifreader.rsmake
msgid "Manufacturer"
msgstr ""
#: uexifreader.rsmodel
msgid "Camera model"
msgstr ""
#: uexifreader.rsorientation
msgid "Orientation"
msgstr ""
#: ulng.msgtrytolocatecrcfile
msgid ""
"This file cannot be found and could help to validate final combination of files:\n"
"%s\n"
"\n"
"Could you make it available and press \"OK\" when ready,\n"
"or press \"CANCEL\" to continue without it?\n"
msgstr ""
#: ulng.rscancelfilter
msgid "Cancel Quick Filter"
msgstr ""
#: ulng.rscanceloperation
msgid "Cancel Current Operation"
msgstr ""
#: ulng.rscaptionforaskingfilename
msgid "Enter filename, with extension, for dropped text"
msgstr ""
#: ulng.rscaptionfortextformattoimport
msgid "Text format to import"
msgstr ""
#: ulng.rschecksumverifybroken
msgid "Broken:"
msgstr ""
#: ulng.rschecksumverifygeneral
msgid "General:"
msgstr ""
#: ulng.rschecksumverifymissing
msgid "Missing:"
msgstr ""
#: ulng.rschecksumverifyreaderror
msgid "Read error:"
msgstr ""
#: ulng.rschecksumverifysuccess
msgid "Success:"
msgstr ""
#: ulng.rschecksumverifytext
msgid "Enter checksum and select algorithm:"
msgstr ""
#: ulng.rschecksumverifytitle
msgid "Verify checksum"
msgstr ""
#: ulng.rschecksumverifytotal
msgid "Total:"
msgstr ""
#: ulng.rsclearfiltersornot
msgid "Do you want to clear filters for this new search?"
msgstr ""
#: ulng.rsclipboardcontainsinvalidtoolbardata
msgid "Clipboard doesn't contain any valid toolbar data."
msgstr ""
#: ulng.rscmdcategorylistinorder
msgid "All;Active Panel;Left Panel;Right Panel;File Operations;Configuration;Network;Miscellaneous;Parallel Port;Print;Mark;Security;Clipboard;FTP;Navigation;Help;Window;Command Line;Tools;View;User;Tabs;Sorting;Log"
msgstr ""
#: ulng.rscmdkindofsort
msgid "Legacy sorted;A-Z sorted"
msgstr ""
#: ulng.rscolattr
msgid "Attr"
msgstr ""
#: ulng.rscoldate
msgctxt "ulng.rscoldate"
msgid "Date"
msgstr ""
#: ulng.rscolext
msgid "Ext"
msgstr ""
#: ulng.rscolname
msgctxt "ulng.rscolname"
msgid "Name"
msgstr ""
#: ulng.rscolsize
msgctxt "ulng.rscolsize"
msgid "Size"
msgstr ""
#: ulng.rsconfcolalign
msgid "Align"
msgstr ""
#: ulng.rsconfcolcaption
msgid "Caption"
msgstr ""
#: ulng.rsconfcoldelete
msgctxt "ulng.rsconfcoldelete"
msgid "Delete"
msgstr ""
#: ulng.rsconfcolfieldcont
msgid "Field contents"
msgstr ""
#: ulng.rsconfcolmove
msgctxt "ulng.rsconfcolmove"
msgid "Move"
msgstr ""
#: ulng.rsconfcolwidth
msgctxt "ulng.rsconfcolwidth"
msgid "Width"
msgstr ""
#: ulng.rsconfcustheader
msgid "Customize column"
msgstr ""
#: ulng.rsconfigurationfileassociation
msgid "Configure file association"
msgstr ""
#: ulng.rsconfirmexecution
msgid "Confirming command line and parameters"
msgstr ""
#: ulng.rscopynametemplate
msgid "Copy (%d) %s"
msgstr ""
#: ulng.rsdefaultimporteddctoolbarhint
msgid "Imported DC toolbar"
msgstr ""
#: ulng.rsdefaultimportedtctoolbarhint
msgid "Imported TC toolbar"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtext
msgid "_DroppedText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtexthtmlfilename
msgid "_DroppedHTMLtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextrichtextfilename
msgid "_DroppedRichtext"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextsimplefilename
msgid "_DroppedSimpleText"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf16filename
msgid "_DroppedUnicodeUTF16text"
msgstr ""
#: ulng.rsdefaultsuffixdroppedtextunicodeutf8filename
msgid "_DroppedUnicodeUTF8text"
msgstr ""
#: ulng.rsdiffadds
msgid " Adds: "
msgstr ""
#: ulng.rsdiffdeletes
msgid " Deletes: "
msgstr ""
#: ulng.rsdifffilesidentical
msgid "The two files are identical!"
msgstr ""
#: ulng.rsdiffmatches
msgid " Matches: "
msgstr ""
#: ulng.rsdiffmodifies
msgid " Modifies: "
msgstr ""
#: ulng.rsdlgbuttonabort
msgid "Ab&ort"
msgstr ""
#: ulng.rsdlgbuttonall
msgctxt "ulng.rsdlgbuttonall"
msgid "A&ll"
msgstr ""
#: ulng.rsdlgbuttonappend
msgid "A&ppend"
msgstr ""
#: ulng.rsdlgbuttonautorenamesource
msgid "A&uto-rename source files"
msgstr ""
#: ulng.rsdlgbuttoncancel
msgctxt "ulng.rsdlgbuttoncancel"
msgid "&Cancel"
msgstr ""
#: ulng.rsdlgbuttoncontinue
msgid "&Continue"
msgstr ""
#: ulng.rsdlgbuttoncopyinto
msgid "&Merge"
msgstr ""
#: ulng.rsdlgbuttoncopyintoall
msgid "Mer&ge All"
msgstr ""
#: ulng.rsdlgbuttonexitprogram
msgid "E&xit program"
msgstr ""
#: ulng.rsdlgbuttonignore
msgid "Ig&nore"
msgstr ""
#: ulng.rsdlgbuttonignoreall
msgid "I&gnore All"
msgstr ""
#: ulng.rsdlgbuttonno
msgid "&No"
msgstr ""
#: ulng.rsdlgbuttonnone
msgid "Non&e"
msgstr ""
#: ulng.rsdlgbuttonok
msgctxt "ulng.rsdlgbuttonok"
msgid "&OK"
msgstr ""
#: ulng.rsdlgbuttonother
msgid "Ot&her"
msgstr ""
#: ulng.rsdlgbuttonoverwrite
msgid "&Overwrite"
msgstr ""
#: ulng.rsdlgbuttonoverwriteall
msgid "Overwrite &All"
msgstr ""
#: ulng.rsdlgbuttonoverwritelarger
msgid "Overwrite All &Larger"
msgstr ""
#: ulng.rsdlgbuttonoverwriteolder
msgid "Overwrite All Ol&der"
msgstr ""
#: ulng.rsdlgbuttonoverwritesmaller
msgid "Overwrite All S&maller"
msgstr ""
#: ulng.rsdlgbuttonrename
msgctxt "ulng.rsdlgbuttonrename"
msgid "R&ename"
msgstr ""
#: ulng.rsdlgbuttonresume
msgid "&Resume"
msgstr ""
#: ulng.rsdlgbuttonretry
msgid "Re&try"
msgstr ""
#: ulng.rsdlgbuttonretryadmin
msgid "As Ad&ministrator"
msgstr ""
#: ulng.rsdlgbuttonskip
msgid "&Skip"
msgstr ""
#: ulng.rsdlgbuttonskipall
msgid "S&kip All"
msgstr ""
#: ulng.rsdlgbuttonyes
msgid "&Yes"
msgstr ""
#: ulng.rsdlgcp
msgctxt "ulng.rsdlgcp"
msgid "Copy file(s)"
msgstr ""
#: ulng.rsdlgmv
msgid "Move file(s)"
msgstr ""
#: ulng.rsdlgoppause
msgid "Pau&se"
msgstr ""
#: ulng.rsdlgopstart
msgctxt "ulng.rsdlgopstart"
msgid "&Start"
msgstr ""
#: ulng.rsdlgqueue
msgid "Queue"
msgstr ""
#: ulng.rsdlgspeed
msgid "Speed %s/s"
msgstr ""
#: ulng.rsdlgspeedtime
msgid "Speed %s/s, time remaining %s"
msgstr ""
#: ulng.rsdraganddroptextformat
msgid "Rich Text Format;HTML Format;Unicode Format;Simple Text Format"
msgstr ""
#: ulng.rsdrivenolabel
msgid "<no label>"
msgstr ""
#: ulng.rsdrivenomedia
msgid "<no media>"
msgstr ""
#: ulng.rseditabouttext
msgid "Internal Editor of Double Commander."
msgstr ""
#: ulng.rseditgotolinequery
msgid "Goto line:"
msgstr ""
#: ulng.rseditgotolinetitle
msgid "Goto Line"
msgstr ""
#: ulng.rseditnewfile
msgid "new.txt"
msgstr ""
#: ulng.rseditnewfilename
msgid "Filename:"
msgstr ""
#: ulng.rseditnewopen
msgid "Open file"
msgstr ""
#: ulng.rseditsearchback
msgid "&Backward"
msgstr ""
#: ulng.rseditsearchcaption
msgid "Search"
msgstr ""
#: ulng.rseditsearchfrw
msgid "&Forward"
msgstr ""
#: ulng.rseditsearchreplace
msgctxt "ulng.rseditsearchreplace"
msgid "Replace"
msgstr ""
#: ulng.rseditwithexternaleditor
msgid "with external editor"
msgstr ""
#: ulng.rseditwithinternaleditor
msgid "with internal editor"
msgstr ""
#: ulng.rsexecuteviashell
msgctxt "ulng.rsexecuteviashell"
msgid "Execute via shell"
msgstr ""
#: ulng.rsexecuteviaterminalclose
msgctxt "ulng.rsexecuteviaterminalclose"
msgid "Execute via terminal and close"
msgstr ""
#: ulng.rsexecuteviaterminalstayopen
msgctxt "ulng.rsexecuteviaterminalstayopen"
msgid "Execute via terminal and stay open"
msgstr ""
#: ulng.rsfavtabspanelsideselection
msgid "Left;Right;Active;Inactive;Both;None"
msgstr ""
#: ulng.rsfavtabssavedirhistory
msgid "No;Yes"
msgstr ""
#: ulng.rsfilenameexportedtcbarprefix
msgid "Exported_from_DC"
msgstr ""
#: ulng.rsfileopdirectoryexistsoptions
msgid "Ask;Merge;Skip"
msgstr ""
#: ulng.rsfileopfileexistsoptions
msgid "Ask;Overwrite;Overwrite Older;Skip"
msgstr ""
#: ulng.rsfileopsetpropertyerroroptions
msgid "Ask;Don't set anymore;Ignore errors"
msgstr ""
#: ulng.rsfilterstatus
msgid "FILTER"
msgstr ""
#: ulng.rsfinddefinetemplate
msgid "Define template"
msgstr ""
#: ulng.rsfinddepth
msgid "%s level(s)"
msgstr ""
#: ulng.rsfinddepthall
msgid "all (unlimited depth)"
msgstr ""
#: ulng.rsfinddepthcurdir
msgid "current dir only"
msgstr ""
#: ulng.rsfinddirnoex
msgid "Directory %s does not exist!"
msgstr ""
#: ulng.rsfindfound
msgid "Found: %d"
msgstr ""
#: ulng.rsfindsavetemplatecaption
msgid "Save search template"
msgstr ""
#: ulng.rsfindsavetemplatetitle
msgid "Template name:"
msgstr ""
#: ulng.rsfindscanned
msgid "Scanned: %d"
msgstr ""
#: ulng.rsfindscanning
msgid "Scanning"
msgstr ""
#: ulng.rsfindsearchfiles
msgctxt "ulng.rsfindsearchfiles"
msgid "Find files"
msgstr ""
#: ulng.rsfindtimeofscan
msgid "Time of scan: "
msgstr ""
#: ulng.rsfindwherebeg
msgid "Begin at"
msgstr ""
#: ulng.rsfreemsg
msgid "Free %s from %s bytes"
msgstr ""
#: ulng.rsfreemsgshort
msgid "%s bytes free"
msgstr ""
#: ulng.rsfuncatime
msgid "Access date/time"
msgstr ""
#: ulng.rsfuncattr
msgctxt "ulng.rsfuncattr"
msgid "Attributes"
msgstr ""
#: ulng.rsfunccomment
msgid "Comment"
msgstr ""
#: ulng.rsfunccompressedsize
msgid "Compressed size"
msgstr ""
#: ulng.rsfuncctime
msgid "Creation date/time"
msgstr ""
#: ulng.rsfuncext
msgid "Extension"
msgstr ""
#: ulng.rsfuncgroup
msgctxt "ulng.rsfuncgroup"
msgid "Group"
msgstr ""
#: ulng.rsfunchtime
msgid "Change date/time"
msgstr ""
#: ulng.rsfunclinkto
msgid "Link to"
msgstr ""
#: ulng.rsfuncmtime
msgid "Modification date/time"
msgstr ""
#: ulng.rsfuncname
msgctxt "ulng.rsfuncname"
msgid "Name"
msgstr ""
#: ulng.rsfuncnamenoext
msgid "Name without extension"
msgstr ""
#: ulng.rsfuncowner
msgctxt "ulng.rsfuncowner"
msgid "Owner"
msgstr ""
#: ulng.rsfuncpath
msgctxt "ulng.rsfuncpath"
msgid "Path"
msgstr ""
#: ulng.rsfuncsize
msgctxt "ulng.rsfuncsize"
msgid "Size"
msgstr ""
#: ulng.rsfunctype
msgid "Type"
msgstr ""
#: ulng.rsharderrcreate
msgid "Error creating hardlink."
msgstr ""
#: ulng.rshotdirforcesortingorderchoices
msgid "none;Name, a-z;Name, z-a;Ext, a-z;Ext, z-a;Size 9-0;Size 0-9;Date 9-0;Date 0-9"
msgstr ""
#: ulng.rshotdirwarningabortrestorebackup
msgid ""
"Warning! When restoring a .hotlist backup file, this will erase existing list to replace by the imported one.\n"
"\n"
"Are you sure you want to proceed?\n"
msgstr ""
#: ulng.rshotkeycategorycopymovedialog
msgid "Copy/Move Dialog"
msgstr ""
#: ulng.rshotkeycategorydiffer
msgctxt "ulng.rshotkeycategorydiffer"
msgid "Differ"
msgstr ""
#: ulng.rshotkeycategoryeditcommentdialog
msgid "Edit Comment Dialog"
msgstr ""
#: ulng.rshotkeycategoryeditor
msgctxt "ulng.rshotkeycategoryeditor"
msgid "Editor"
msgstr ""
#: ulng.rshotkeycategoryfindfiles
msgctxt "ulng.rshotkeycategoryfindfiles"
msgid "Find files"
msgstr ""
#: ulng.rshotkeycategorymain
msgid "Main"
msgstr ""
#: ulng.rshotkeycategoryviewer
msgctxt "ulng.rshotkeycategoryviewer"
msgid "Viewer"
msgstr ""
#: ulng.rshotkeyfilealreadyexists
msgid ""
"A setup with that name already exists.\n"
"Do you want to overwrite it?\n"
msgstr ""
#: ulng.rshotkeyfileconfirmdefault
msgid "Are you sure you want to restore default?"
msgstr ""
#: ulng.rshotkeyfileconfirmerasure
msgid "Are you sure you want to erase setup \"%s\"?"
msgstr ""
#: ulng.rshotkeyfilecopyof
msgid "Copy of %s"
msgstr ""
#: ulng.rshotkeyfileinputnewname
msgid "Input your new name"
msgstr ""
#: ulng.rshotkeyfilemustkeepone
msgid "You must keep at least one shortcut file."
msgstr ""
#: ulng.rshotkeyfilenewname
msgid "New name"
msgstr ""
#: ulng.rshotkeyfilesavemodified
msgid ""
"\"%s\" setup has been modified.\n"
"Do you want to save it now?\n"
msgstr ""
#: ulng.rshotkeynoscenter
msgid "No shortcut with \"ENTER\""
msgstr ""
#: ulng.rshotkeysortorder
msgid "By command name;By shortcut key (grouped);By shortcut key (one per row)"
msgstr ""
#: ulng.rsimporttoolbarproblem
msgid "Cannot find reference to default bar file"
msgstr ""
#: ulng.rslistoffindfileswindows
msgid "List of \"Find files\" windows"
msgstr ""
#: ulng.rsmarkminus
msgid "Unselect mask"
msgstr ""
#: ulng.rsmarkplus
msgid "Select mask"
msgstr ""
#: ulng.rsmaskinput
msgid "Input mask:"
msgstr ""
#: ulng.rsmenuconfigurecolumnsalreadyexists
msgid "A columns view with that name already exists."
msgstr ""
#: ulng.rsmenuconfigurecolumnssavetochange
msgid "To change current editing colmuns view, either SAVE, COPY or DELETE current editing one"
msgstr ""
#: ulng.rsmenuconfigurecustomcolumns
msgid "Configure custom columns"
msgstr ""
#: ulng.rsmenuconfigureentercustomcolumnname
msgid "Enter new custom columns name"
msgstr ""
#: ulng.rsmnuactions
msgctxt "ulng.rsmnuactions"
msgid "Actions"
msgstr ""
#: ulng.rsmnucopynetnamestoclip
msgid "Copy names with UNC path"
msgstr ""
#: ulng.rsmnudisconnectnetworkdrive
msgid "Disconnect Network Drive..."
msgstr ""
#: ulng.rsmnuedit
msgctxt "ulng.rsmnuedit"
msgid "Edit"
msgstr ""
#: ulng.rsmnueject
msgid "Eject"
msgstr ""
#: ulng.rsmnuextracthere
msgid "Extract here..."
msgstr ""
#: ulng.rsmnumapnetworkdrive
msgid "Map Network Drive..."
msgstr ""
#: ulng.rsmnumount
msgid "Mount"
msgstr ""
#: ulng.rsmnunew
msgctxt "ulng.rsmnunew"
msgid "New"
msgstr ""
#: ulng.rsmnunomedia
msgid "No media available"
msgstr ""
#: ulng.rsmnuopen
msgctxt "ulng.rsmnuopen"
msgid "Open"
msgstr ""
#: ulng.rsmnuopenwith
msgid "Open with"
msgstr ""
#: ulng.rsmnuopenwithother
msgctxt "ulng.rsmnuopenwithother"
msgid "Other..."
msgstr ""
#: ulng.rsmnupackhere
msgid "Pack here..."
msgstr ""
#: ulng.rsmnusortby
msgid "Sort by"
msgstr ""
#: ulng.rsmnuumount
msgid "Unmount"
msgstr ""
#: ulng.rsmnuview
msgctxt "ulng.rsmnuview"
msgid "View"
msgstr ""
#: ulng.rsmsgaccount
msgid "Account:"
msgstr ""
#: ulng.rsmsgarchivercustomparams
msgid "Additional parameters for archiver command-line:"
msgstr ""
#: ulng.rsmsgaskquoteornot
msgid "Do you want to enclose between quotes?"
msgstr ""
#: ulng.rsmsgbadcrc32
msgid ""
"Bad CRC32 for resulting file:\n"
"\"%s\"\n"
"\n"
"Do you want to keep the resulting corrupted file anyway?\n"
msgstr ""
#: ulng.rsmsgcannotcopymoveitself
msgid "You can not copy/move a file \"%s\" to itself!"
msgstr ""
#: ulng.rsmsgcannotdeletedirectory
msgid "Cannot delete directory %s"
msgstr ""
#: ulng.rsmsgcannotoverwritedirectory
msgid "Cannot overwrite directory \"%s\" with non-directory \"%s\""
msgstr ""
#: ulng.rsmsgchdirfailed
msgid "ChDir to [%s] failed!"
msgstr ""
#: ulng.rsmsgcloseallinactivetabs
msgid "Remove all inactive tabs?"
msgstr ""
#: ulng.rsmsgcloselockedtab
msgid "This tab (%s) is locked! Close anyway?"
msgstr ""
#: ulng.rsmsgconfirmquit
msgid "Are you sure you want to quit?"
msgstr ""
#: ulng.rsmsgcopybackward
msgid "The file %s has changed. Do you want to copy it backward?"
msgstr ""
#: ulng.rsmsgcouldnotcopybackward
msgid "Could not copy backward - do you want to keep the changed file?"
msgstr ""
#: ulng.rsmsgcpfldr
msgid "Copy %d selected files/directories?"
msgstr ""
#: ulng.rsmsgcpsel
msgid "Copy selected \"%s\"?"
msgstr ""
#: ulng.rsmsgcreateanewfiletype
msgid "< Create a new file type \"%s files\" >"
msgstr ""
#: ulng.rsmsgdctoolbarwheretosave
msgid "Enter location and filename where to save a DC Toolbar file"
msgstr ""
#: ulng.rsmsgdefaultcustomactionname
msgid "Custom action"
msgstr ""
#: ulng.rsmsgdeletepartiallycopied
msgid "Delete the partially copied file ?"
msgstr ""
#: ulng.rsmsgdelfldr
msgid "Delete %d selected files/directories?"
msgstr ""
#: ulng.rsmsgdelfldrt
msgid "Delete %d selected files/directories into trash can?"
msgstr ""
#: ulng.rsmsgdelsel
msgid "Delete selected \"%s\"?"
msgstr ""
#: ulng.rsmsgdelselt
msgid "Delete selected \"%s\" into trash can?"
msgstr ""
#: ulng.rsmsgdeltotrashforce
msgid "Can not delete \"%s\" to trash! Delete directly?"
msgstr ""
#: ulng.rsmsgdisknotavail
msgid "Disk is not available"
msgstr ""
#: ulng.rsmsgentercustomaction
msgid "Enter custom action name:"
msgstr ""
#: ulng.rsmsgenterfileext
msgid "Enter file extension:"
msgstr ""
#: ulng.rsmsgentername
msgid "Enter name:"
msgstr ""
#: ulng.rsmsgenternewfiletypename
msgid "Enter name of new file type to create for extension \"%s\""
msgstr ""
#: ulng.rsmsgerrbadarchive
msgid "CRC error in archive data"
msgstr ""
#: ulng.rsmsgerrbaddata
msgid "Data is bad"
msgstr ""
#: ulng.rsmsgerrcannotconnect
msgid "Can not connect to server: \"%s\""
msgstr ""
#: ulng.rsmsgerrcannotcopyfile
msgid "Cannot copy file %s to %s"
msgstr ""
#: ulng.rsmsgerrcreatefiledirectoryexists
msgid "There already exists a directory named \"%s\"."
msgstr ""
#: ulng.rsmsgerrdatenotsupported
msgid "Date %s is not supported"
msgstr ""
#: ulng.rsmsgerrdirexists
msgid "Directory %s exists!"
msgstr ""
#: ulng.rsmsgerreaborted
msgid "Function aborted by user"
msgstr ""
#: ulng.rsmsgerreclose
msgid "Error closing file"
msgstr ""
#: ulng.rsmsgerrecreate
msgid "Cannot create file"
msgstr ""
#: ulng.rsmsgerrendarchive
msgid "No more files in archive"
msgstr ""
#: ulng.rsmsgerreopen
msgid "Cannot open existing file"
msgstr ""
#: ulng.rsmsgerreread
msgid "Error reading from file"
msgstr ""
#: ulng.rsmsgerrewrite
msgid "Error writing to file"
msgstr ""
#: ulng.rsmsgerrforcedir
msgid "Can not create directory %s!"
msgstr ""
#: ulng.rsmsgerrinvalidlink
msgid "Invalid link"
msgstr ""
#: ulng.rsmsgerrnofiles
msgid "No files found"
msgstr ""
#: ulng.rsmsgerrnomemory
msgid "Not enough memory"
msgstr ""
#: ulng.rsmsgerrnotsupported
msgid "Function not supported!"
msgstr ""
#: ulng.rsmsgerrorincontextmenucommand
msgid "Error in context menu command"
msgstr ""
#: ulng.rsmsgerrorloadingconfiguration
msgid "Error when loading configuration"
msgstr ""
#: ulng.rsmsgerrregexpsyntax
msgid "Syntax error in regular expression!"
msgstr ""
#: ulng.rsmsgerrrename
msgid "Cannot rename file %s to %s"
msgstr ""
#: ulng.rsmsgerrsaveassociation
msgid "Can not save association!"
msgstr ""
#: ulng.rsmsgerrsavefile
msgid "Cannot save file"
msgstr ""
#: ulng.rsmsgerrsetattribute
msgid "Can not set attributes for \"%s\""
msgstr ""
#: ulng.rsmsgerrsetdatetime
msgid "Can not set date/time for \"%s\""
msgstr ""
#: ulng.rsmsgerrsetownership
msgid "Can not set owner/group for \"%s\""
msgstr ""
#: ulng.rsmsgerrsetpermissions
msgid "Can not set permissions for \"%s\""
msgstr ""
#: ulng.rsmsgerrsmallbuf
msgid "Buffer too small"
msgstr ""
#: ulng.rsmsgerrtoomanyfiles
msgid "Too many files to pack"
msgstr ""
#: ulng.rsmsgerrunknownformat
msgid "Archive format unknown"
msgstr ""
#: ulng.rsmsgfavoritetabsdeleteallentries
msgid "Are you sure you want to remove all entries of your Favorite Tabs? (There is no \"undo\" to this action!)"
msgstr ""
#: ulng.rsmsgfavoritetabsdraghereentry
msgid "Drag here other entries"
msgstr ""
#: ulng.rsmsgfavoritetabsentername
msgid "Enter a name this Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsenternametitle
msgid "Saving a new Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfavoritetabsexportedsuccessfully
msgid "Number of Favorite Tabs exported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsextramode
msgid "Default extra setting for save dir history for new Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabsimportedsuccessfully
msgid "Number of file(s) imported successfully: %d on %d"
msgstr ""
#: ulng.rsmsgfavoritetabsimportsubmenuname
msgid "Legacy tabs imported"
msgstr ""
#: ulng.rsmsgfavoritetabsimporttitle
msgid "Select .tab file(s) to import (could be more than one at the time!)"
msgstr ""
#: ulng.rsmsgfavoritetabsmodifiednoimport
msgid "Last Favorite Tabs modification have been saved yet. Do you want to save them prior to continue?"
msgstr ""
#: ulng.rsmsgfavoritetabssimplemode
msgctxt "ulng.rsmsgfavoritetabssimplemode"
msgid "Keep saving dir history with Favorite Tabs:"
msgstr ""
#: ulng.rsmsgfavoritetabssubmenuname
msgctxt "ulng.rsmsgfavoritetabssubmenuname"
msgid "Submenu name"
msgstr ""
#: ulng.rsmsgfavoritetabsthiswillloadfavtabs
msgid "This will load the Favorite Tabs: \"%s\""
msgstr ""
#: ulng.rsmsgfavortietabssaveoverexisting
msgid "Save current tabs over existing Favorite Tabs entry"
msgstr ""
#: ulng.rsmsgfilechangedsave
msgid "File %s changed, save?"
msgstr ""
#: ulng.rsmsgfileexistsfileinfo
msgid "%s bytes, %s"
msgstr ""
#: ulng.rsmsgfileexistsoverwrite
msgid "Overwrite:"
msgstr ""
#: ulng.rsmsgfileexistsrwrt
msgid "File %s exists, overwrite?"
msgstr ""
#: ulng.rsmsgfileexistswithfile
msgid "With file:"
msgstr ""
#: ulng.rsmsgfilenotfound
msgid "File \"%s\" not found."
msgstr ""
#: ulng.rsmsgfileoperationsactive
msgid "File operations active"
msgstr ""
#: ulng.rsmsgfileoperationsactivelong
msgid "Some file operations have not yet finished. Closing Double Commander may result in data loss."
msgstr ""
#: ulng.rsmsgfilepathovermaxpath
msgid ""
"The target name length (%d) is more than %d characters!\n"
"%s\n"
"Most programs will not be able to access a file/directory with such a long name!\n"
msgstr ""
#: ulng.rsmsgfilereadonly
msgid "File %s is marked as read-only/hidden/system. Delete it?"
msgstr ""
#: ulng.rsmsgfilesizetoobig
msgid "The file size of \"%s\" is too big for destination file system!"
msgstr ""
#: ulng.rsmsgfolderexistsrwrt
msgid "Folder %s exists, merge?"
msgstr ""
#: ulng.rsmsgfollowsymlink
msgid "Follow symlink \"%s\"?"
msgstr ""
#: ulng.rsmsgfortextformattoimport
msgid "Select the text format to import"
msgstr ""
#: ulng.rsmsghotdiraddselecteddirectories
msgid "Add %d selected dirs"
msgstr ""
#: ulng.rsmsghotdiraddselecteddirectory
msgid "Add selected dir: "
msgstr ""
#: ulng.rsmsghotdiraddthisdirectory
msgid "Add current dir: "
msgstr ""
#: ulng.rsmsghotdircommandname
msgid "Do command"
msgstr ""
#: ulng.rsmsghotdircommandsample
msgid "cm_somthing"
msgstr ""
#: ulng.rsmsghotdirconfighotlist
msgctxt "ulng.rsmsghotdirconfighotlist"
msgid "Configuration of Directory Hotlist"
msgstr ""
#: ulng.rsmsghotdirdeleteallentries
msgid "Are you sure you want to remove all entries of your Directory Hotlist? (There is no \"undo\" to this action!)"
msgstr ""
#: ulng.rsmsghotdirdemocommand
msgid "This will execute the following command:"
msgstr ""
#: ulng.rsmsghotdirdemoname
msgid "This is hot dir named "
msgstr ""
#: ulng.rsmsghotdirdemopath
msgid "This will change active frame to the following path:"
msgstr ""
#: ulng.rsmsghotdirdemotarget
msgid "And inactive frame would change to the following path:"
msgstr ""
#: ulng.rsmsghotdirerrorbackuping
msgid "Error backuping entries..."
msgstr ""
#: ulng.rsmsghotdirerrorexporting
msgid "Error exporting entries..."
msgstr ""
#: ulng.rsmsghotdirexportall
msgid "Export all!"
msgstr ""
#: ulng.rsmsghotdirexporthotlist
msgid "Export Directory Hotlist - Select the entries you want to export"
msgstr ""
#: ulng.rsmsghotdirexportsel
msgid "Export selected"
msgstr ""
#: ulng.rsmsghotdirimportall
msgctxt "ulng.rsmsghotdirimportall"
msgid "Import all!"
msgstr ""
#: ulng.rsmsghotdirimporthotlist
msgid "Import Directory Hotlist - Select the entries you want to import"
msgstr ""
#: ulng.rsmsghotdirimportsel
msgctxt "ulng.rsmsghotdirimportsel"
msgid "Import selected"
msgstr ""
#: ulng.rsmsghotdirjustpath
msgctxt "ulng.rsmsghotdirjustpath"
msgid "Path"
msgstr ""
#: ulng.rsmsghotdirlocatehotlistfile
msgid "Locate \".hotlist\" file to import"
msgstr ""
#: ulng.rsmsghotdirname
msgid "Hotdir name"
msgstr ""
#: ulng.rsmsghotdirnbnewentries
msgid "Number of new entries: %d"
msgstr ""
#: ulng.rsmsghotdirnothingtoexport
msgid "Nothing selected to export!"
msgstr ""
#: ulng.rsmsghotdirpath
msgid "Hotdir path"
msgstr ""
#: ulng.rsmsghotdirreaddselecteddirectory
msgid "Re-Add selected dir: "
msgstr ""
#: ulng.rsmsghotdirreaddthisdirectory
msgid "Re-Add current dir: "
msgstr ""
#: ulng.rsmsghotdirrestorewhat
msgid "Enter location and filename of Directory Hotlist to restore"
msgstr ""
#: ulng.rsmsghotdirsimplecommand
msgctxt "ulng.rsmsghotdirsimplecommand"
msgid "Command:"
msgstr ""
#: ulng.rsmsghotdirsimpleendofmenu
msgctxt "ulng.rsmsghotdirsimpleendofmenu"
msgid "(end of sub menu)"
msgstr ""
#: ulng.rsmsghotdirsimplemenu
msgctxt "ulng.rsmsghotdirsimplemenu"
msgid "Menu name:"
msgstr ""
#: ulng.rsmsghotdirsimplename
msgctxt "ulng.rsmsghotdirsimplename"
msgid "Name:"
msgstr ""
#: ulng.rsmsghotdirsimpleseparator
msgctxt "ulng.rsmsghotdirsimpleseparator"
msgid "(separator)"
msgstr ""
#: ulng.rsmsghotdirsubmenuname
msgctxt "ulng.rsmsghotdirsubmenuname"
msgid "Submenu name"
msgstr ""
#: ulng.rsmsghotdirtarget
msgid "Hotdir target"
msgstr ""
#: ulng.rsmsghotdirtiporderpath
msgid "Determine if you want the active frame to be sorted in a specified order after changing directory"
msgstr ""
#: ulng.rsmsghotdirtipordertarget
msgid "Determine if you want the not active frame to be sorted in a specified order after changing directory"
msgstr ""
#: ulng.rsmsghotdirtipspecialdirbut
msgid "Some functions to select appropriate path relative, absolute, windows special folders, etc."
msgstr ""
#: ulng.rsmsghotdirtotalbackuped
msgid ""
"Total entries saved: %d\n"
"\n"
"Backup filename: %s\n"
msgstr ""
#: ulng.rsmsghotdirtotalexported
msgid "Total entries exported: "
msgstr ""
#: ulng.rsmsghotdirwhattodelete
msgid ""
"Do you want to delete all elements inside the sub-menu [%s]?\n"
"Answering NO will delete only menu delimiters but will keep element inside sub-menu.\n"
msgstr ""
#: ulng.rsmsghotdirwheretosave
msgid "Enter location and filename where to save a Directory Hotlist file"
msgstr ""
#: ulng.rsmsgincorrectfilelength
msgid "Incorrect resulting filelength for file : \"%s\""
msgstr ""
#: ulng.rsmsginsertnextdisk
msgid ""
"Please insert next disk or something similar.\n"
"\n"
"It is to allow writing this file:\n"
"\"%s\"\n"
"\n"
"Number of bytes still to write: %d\n"
msgstr ""
#: ulng.rsmsginvalidcommandline
msgid "Error in command line"
msgstr ""
#: ulng.rsmsginvalidfilename
msgid "Invalid filename"
msgstr ""
#: ulng.rsmsginvalidformatofconfigurationfile
msgid "Invalid format of configuration file"
msgstr ""
#: ulng.rsmsginvalidpath
msgid "Invalid path"
msgstr ""
#: ulng.rsmsginvalidpathlong
msgid "Path %s contains forbidden characters."
msgstr ""
#: ulng.rsmsginvalidplugin
msgid "This is not a valid plugin!"
msgstr ""
#: ulng.rsmsginvalidpluginarchitecture
msgid "This plugin is built for Double Commander for %s.%sIt can not work with Double Commander for %s!"
msgstr ""
#: ulng.rsmsginvalidquoting
msgid "Invalid quoting"
msgstr ""
#: ulng.rsmsginvalidselection
msgid "Invalid selection."
msgstr ""
#: ulng.rsmsgloadingfilelist
msgid "Loading file list..."
msgstr ""
#: ulng.rsmsglocatetcconfiguation
msgid "Locate TC configuration file (wincmd.ini)"
msgstr ""
#: ulng.rsmsglocatetcexecutable
msgid "Locate TC executable file (totalcmd.exe or totalcmd64.exe)"
msgstr ""
#: ulng.rsmsglogcopy
msgid "Copy file %s"
msgstr ""
#: ulng.rsmsglogdelete
msgid "Delete file %s"
msgstr ""
#: ulng.rsmsglogerror
msgid "Error: "
msgstr ""
#: ulng.rsmsglogextcmdlaunch
msgid "Launch external"
msgstr ""
#: ulng.rsmsglogextcmdresult
msgid "Result external"
msgstr ""
#: ulng.rsmsglogextract
msgid "Extract file %s"
msgstr ""
#: ulng.rsmsgloginfo
msgid "Info: "
msgstr ""
#: ulng.rsmsgloglink
msgid "Create link %s"
msgstr ""
#: ulng.rsmsglogmkdir
msgid "Create directory %s"
msgstr ""
#: ulng.rsmsglogmove
msgid "Move file %s"
msgstr ""
#: ulng.rsmsglogpack
msgid "Pack to file %s"
msgstr ""
#: ulng.rsmsglogrmdir
msgid "Remove directory %s"
msgstr ""
#: ulng.rsmsglogsuccess
msgid "Done: "
msgstr ""
#: ulng.rsmsglogsymlink
msgid "Create symlink %s"
msgstr ""
#: ulng.rsmsglogtest
msgid "Test file integrity %s"
msgstr ""
#: ulng.rsmsglogwipe
msgid "Wipe file %s"
msgstr ""
#: ulng.rsmsglogwipedir
msgid "Wipe directory %s"
msgstr ""
#: ulng.rsmsgmasterpassword
msgid "Master Password"
msgstr ""
#: ulng.rsmsgmasterpasswordenter
msgid "Please enter the master password:"
msgstr ""
#: ulng.rsmsgnewfile
msgid "New file"
msgstr ""
#: ulng.rsmsgnextvolunpack
msgid "Next volume will be unpacked"
msgstr ""
#: ulng.rsmsgnofiles
msgid "No files"
msgstr ""
#: ulng.rsmsgnofilesselected
msgid "No files selected."
msgstr ""
#: ulng.rsmsgnofreespacecont
msgid "No enough free space on target drive, Continue?"
msgstr ""
#: ulng.rsmsgnofreespaceretry
msgid "No enough free space on target drive, Retry?"
msgstr ""
#: ulng.rsmsgnotdelete
msgid "Can not delete file %s"
msgstr ""
#: ulng.rsmsgnotimplemented
msgid "Not implemented."
msgstr ""
#: ulng.rsmsgpanelpreview
msgctxt "ulng.rsmsgpanelpreview"
msgid "Below is a preview. You may move cursor and select files to get immediately an actual look and feel of the various settings."
msgstr ""
#: ulng.rsmsgpassword
msgid "Password:"
msgstr ""
#: ulng.rsmsgpassworddiff
msgid "Passwords are different!"
msgstr ""
#: ulng.rsmsgpasswordenter
msgid "Please enter the password:"
msgstr ""
#: ulng.rsmsgpasswordfirewall
msgid "Password (Firewall):"
msgstr ""
#: ulng.rsmsgpasswordverify
msgid "Please re-enter the password for verification:"
msgstr ""
#: ulng.rsmsgpopuphotdelete
msgid "&Delete %s"
msgstr ""
#: ulng.rsmsgpresetalreadyexists
msgid "Preset \"%s\" already exists. Overwrite?"
msgstr ""
#: ulng.rsmsgproblemexecutingcommand
msgid "Problem executing command (%s)"
msgstr ""
#: ulng.rsmsgpromptaskingfilename
msgid "Filename for dropped text:"
msgstr ""
#: ulng.rsmsgprovidethisfile
msgid "Please, make this file available. Retry?"
msgstr ""
#: ulng.rsmsgrenamefavtabs
msgid "Enter new friendly name for this Favorite Tabs"
msgstr ""
#: ulng.rsmsgrenamefavtabsmenu
msgid "Enter new name for this menu"
msgstr ""
#: ulng.rsmsgrenfldr
msgid "Rename/move %d selected files/directories?"
msgstr ""
#: ulng.rsmsgrensel
msgid "Rename/move selected \"%s\"?"
msgstr ""
#: ulng.rsmsgrestartforapplychanges
msgid "Please, restart Double Commander in order to apply changes"
msgstr ""
#: ulng.rsmsgsekectfiletype
msgid "Select to which file type to add extension \"%s\""
msgstr ""
#: ulng.rsmsgselectedinfo
msgid "Selected: %s of %s, files: %d of %d, folders: %d of %d"
msgstr ""
#: ulng.rsmsgselectexecutablefile
msgid "Select executable file for"
msgstr ""
#: ulng.rsmsgselectonlychecksumfiles
msgid "Please select only checksum files!"
msgstr ""
#: ulng.rsmsgsellocnextvol
msgid "Please select location of next volume"
msgstr ""
#: ulng.rsmsgsetvolumelabel
msgid "Set volume label"
msgstr ""
#: ulng.rsmsgspecialdir
msgid "Special Dirs"
msgstr ""
#: ulng.rsmsgspecialdiraddacti
msgid "Add path from active frame"
msgstr ""
#: ulng.rsmsgspecialdiraddnonacti
msgid "Add path from inactive frame"
msgstr ""
#: ulng.rsmsgspecialdirbrowssel
msgid "Browse and use selected path"
msgstr ""
#: ulng.rsmsgspecialdirenvvar
msgid "Use environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirgotodc
msgid "Go to Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirgotoenvvar
msgid "Go to environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirgotoother
msgid "Go to other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirgototc
msgid "Go to Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgspecialdirmakereltohotdir
msgid "Make relative to hotdir path"
msgstr ""
#: ulng.rsmsgspecialdirmkabso
msgid "Make path absolute"
msgstr ""
#: ulng.rsmsgspecialdirmkdcrel
msgid "Make relative to Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirmkenvrel
msgid "Make relative to environment variable..."
msgstr ""
#: ulng.rsmsgspecialdirmktctel
msgid "Make relative to Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgspecialdirmkwnrel
msgid "Make relative to other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirusedc
msgid "Use Double Commander special path..."
msgstr ""
#: ulng.rsmsgspecialdirusehotdir
msgid "Use hotdir path"
msgstr ""
#: ulng.rsmsgspecialdiruseother
msgid "Use other Windows special folder..."
msgstr ""
#: ulng.rsmsgspecialdirusetc
msgid "Use Windows special folder (TC)..."
msgstr ""
#: ulng.rsmsgtabforopeninginnewtab
msgid "This tab (%s) is locked! Open directory in another tab?"
msgstr ""
#: ulng.rsmsgtabrenamecaption
msgid "Rename tab"
msgstr ""
#: ulng.rsmsgtabrenameprompt
msgid "New tab name:"
msgstr ""
#: ulng.rsmsgtargetdir
msgid "Target path:"
msgstr ""
#: ulng.rsmsgtcconfignotfound
msgid ""
"Error! Cannot find the TC configuration file:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtcexecutablenotfound
msgid ""
"Error! Cannot find the TC configuration executable:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtcisrunning
msgid ""
"Error! TC is still running but it should be closed for this operation.\n"
"Close it and press OK or press CANCEL to abort.\n"
msgstr ""
#: ulng.rsmsgtctoolbarnotfound
msgid ""
"Error! Cannot find the desired wanted TC toolbar output folder:\n"
"%s\n"
msgstr ""
#: ulng.rsmsgtctoolbarwheretosave
msgid "Enter location and filename where to save a TC Toolbar file"
msgstr ""
#: ulng.rsmsgthisisnowinclipboard
msgid "\"%s\" is now in the clipboard"
msgstr ""
#: ulng.rsmsgtitleextnotinfiletype
msgid "Extension of selected file is not in any recognized file types"
msgstr ""
#: ulng.rsmsgtoolbarlocatedctoolbarfile
msgid "Locate \".toolbar\" file to import"
msgstr ""
#: ulng.rsmsgtoolbarlocatetctoolbarfile
msgid "Locate \".BAR\" file to import"
msgstr ""
#: ulng.rsmsgtoolbarrestorewhat
msgid "Enter location and filename of Toolbar to restore"
msgstr ""
#: ulng.rsmsgtoolbarsaved
msgid ""
"Saved!\n"
"Toolbar filename: %s\n"
msgstr ""
#: ulng.rsmsgtoomanyfilesselected
msgid "Too many files selected."
msgstr ""
#: ulng.rsmsgundeterminednumberoffile
msgid "Undetermined"
msgstr ""
#: ulng.rsmsgunexpectedusagetreeviewmenu
msgid "ERROR: Unexpected Tree View Menu usage!"
msgstr ""
#: ulng.rsmsgurl
msgid "URL:"
msgstr ""
#: ulng.rsmsguserdidnotsetextension
msgid "<NO EXT>"
msgstr ""
#: ulng.rsmsguserdidnotsetname
msgid "<NO NAME>"
msgstr ""
#: ulng.rsmsgusername
msgid "User name:"
msgstr ""
#: ulng.rsmsgusernamefirewall
msgid "User name (Firewall):"
msgstr ""
#: ulng.rsmsgvolumelabel
msgid "Volume label:"
msgstr ""
#: ulng.rsmsgvolumesizeenter
msgid "Please enter the volume size:"
msgstr ""
#: ulng.rsmsgwipefldr
msgid "Wipe %d selected files/directories?"
msgstr ""
#: ulng.rsmsgwipesel
msgid "Wipe selected \"%s\"?"
msgstr ""
#: ulng.rsmsgwithactionwith
msgid "with"
msgstr ""
#: ulng.rsmulrenfilenamestylelist
msgid "No change;UPPERCASE;lowercase;First char uppercase;First Char Of Every Word Uppercase;"
msgstr ""
#: ulng.rsmulrenwronglinesnumber
msgid "File contains wrong number of lines: %d, should be %d!"
msgstr ""
#: ulng.rsnewsearchclearfilteroptions
msgid "Keep;Clear;Prompt"
msgstr ""
#: ulng.rsnoequivalentinternalcommand
msgid "No internal equivalent command"
msgstr ""
#: ulng.rsnofindfileswindowyet
msgid "Sorry, no \"Find files\" window yet..."
msgstr ""
#: ulng.rsnootherfindfileswindowtoclose
msgid "Sorry, no other \"Find files\" window to close and free from memory..."
msgstr ""
#: ulng.rsoperaborted
msgid "Aborted"
msgstr ""
#: ulng.rsopercalculatingchecksum
msgid "Calculating checksum"
msgstr ""
#: ulng.rsopercalculatingchecksumin
msgid "Calculating checksum in \"%s\""
msgstr ""
#: ulng.rsopercalculatingchecksumof
msgid "Calculating checksum of \"%s\""
msgstr ""
#: ulng.rsopercalculatingstatictics
msgid "Calculating"
msgstr ""
#: ulng.rsopercalculatingstatisticsin
msgid "Calculating \"%s\""
msgstr ""
#: ulng.rsopercombining
msgid "Joining"
msgstr ""
#: ulng.rsopercombiningfromto
msgid "Joining files in \"%s\" to \"%s\""
msgstr ""
#: ulng.rsopercopying
msgid "Copying"
msgstr ""
#: ulng.rsopercopyingfromto
msgid "Copying from \"%s\" to \"%s\""
msgstr ""
#: ulng.rsopercopyingsomethingto
msgid "Copying \"%s\" to \"%s\""
msgstr ""
#: ulng.rsopercreatingdirectory
msgid "Creating directory"
msgstr ""
#: ulng.rsopercreatingsomedirectory
msgid "Creating directory \"%s\""
msgstr ""
#: ulng.rsoperdeleting
msgid "Deleting"
msgstr ""
#: ulng.rsoperdeletingin
msgid "Deleting in \"%s\""
msgstr ""
#: ulng.rsoperdeletingsomething
msgid "Deleting \"%s\""
msgstr ""
#: ulng.rsoperexecuting
msgid "Executing"
msgstr ""
#: ulng.rsoperexecutingsomething
msgid "Executing \"%s\""
msgstr ""
#: ulng.rsoperextracting
msgid "Extracting"
msgstr ""
#: ulng.rsoperextractingfromto
msgid "Extracting from \"%s\" to \"%s\""
msgstr ""
#: ulng.rsoperfinished
msgid "Finished"
msgstr ""
#: ulng.rsoperlisting
msgid "Listing"
msgstr ""
#: ulng.rsoperlistingin
msgid "Listing \"%s\""
msgstr ""
#: ulng.rsopermoving
msgid "Moving"
msgstr ""
#: ulng.rsopermovingfromto
msgid "Moving from \"%s\" to \"%s\""
msgstr ""
#: ulng.rsopermovingsomethingto
msgid "Moving \"%s\" to \"%s\""
msgstr ""
#: ulng.rsopernotstarted
msgid "Not started"
msgstr ""
#: ulng.rsoperpacking
msgid "Packing"
msgstr ""
#: ulng.rsoperpackingfromto
msgid "Packing from \"%s\" to \"%s\""
msgstr ""
#: ulng.rsoperpackingsomethingto
msgid "Packing \"%s\" to \"%s\""
msgstr ""
#: ulng.rsoperpaused
msgid "Paused"
msgstr ""
#: ulng.rsoperpausing
msgid "Pausing"
msgstr ""
#: ulng.rsoperrunning
msgid "Running"
msgstr ""
#: ulng.rsopersettingproperty
msgid "Setting property"
msgstr ""
#: ulng.rsopersettingpropertyin
msgid "Setting property in \"%s\""
msgstr ""
#: ulng.rsopersettingpropertyof
msgid "Setting property of \"%s\""
msgstr ""
#: ulng.rsopersplitting
msgid "Splitting"
msgstr ""
#: ulng.rsopersplittingfromto
msgid "Splitting \"%s\" to \"%s\""
msgstr ""
#: ulng.rsoperstarting
msgid "Starting"
msgstr ""
#: ulng.rsoperstopped
msgid "Stopped"
msgstr ""
#: ulng.rsoperstopping
msgid "Stopping"
msgstr ""
#: ulng.rsopertesting
msgid "Testing"
msgstr ""
#: ulng.rsopertestingin
msgid "Testing in \"%s\""
msgstr ""
#: ulng.rsopertestingsomething
msgid "Testing \"%s\""
msgstr ""
#: ulng.rsoperverifyingchecksum
msgid "Verifying checksum"
msgstr ""
#: ulng.rsoperverifyingchecksumin
msgid "Verifying checksum in \"%s\""
msgstr ""
#: ulng.rsoperverifyingchecksumof
msgid "Verifying checksum of \"%s\""
msgstr ""
#: ulng.rsoperwaitingforconnection
msgid "Waiting for access to file source"
msgstr ""
#: ulng.rsoperwaitingforfeedback
msgid "Waiting for user response"
msgstr ""
#: ulng.rsoperwiping
msgid "Wiping"
msgstr ""
#: ulng.rsoperwipingin
msgid "Wiping in \"%s\""
msgstr ""
#: ulng.rsoperwipingsomething
msgid "Wiping \"%s\""
msgstr ""
#: ulng.rsoperworking
msgid "Working"
msgstr ""
#: ulng.rsoptaddfrommainpanel
msgid "Add at beginning;Add at the end;Smart add"
msgstr ""
#: ulng.rsoptarchivedelete
msgid "Delete:"
msgstr ""
#: ulng.rsoptarchiveextractwithoutpath
msgid "Extract without path:"
msgstr ""
#: ulng.rsoptarchiveformmode
msgid "Format parsing mode:"
msgstr ""
#: ulng.rsoptarchiveid
msgid "ID:"
msgstr ""
#: ulng.rsoptarchiveidpos
msgid "ID Position:"
msgstr ""
#: ulng.rsoptarchiveidseekrange
msgid "ID Seek Range:"
msgstr ""
#: ulng.rsoptarchiveparam
msgid "Parameter"
msgstr ""
#: ulng.rsoptarchivepasswordquery
msgid "Password query string:"
msgstr ""
#: ulng.rsoptarchiveselfextract
msgid "Create self extracting archive:"
msgstr ""
#: ulng.rsoptarchivetest
msgid "Test:"
msgstr ""
#: ulng.rsoptarchivetypename
msgid "Archive type name:"
msgstr ""
#: ulng.rsoptarchivevalue
msgctxt "ulng.rsoptarchivevalue"
msgid "Value"
msgstr ""
#: ulng.rsoptassocpluginwith
msgid "Associate plugin \"%s\" with:"
msgstr ""
#: ulng.rsoptautosizecolumn
msgid "First;Last;"
msgstr ""
#: ulng.rsoptconfigsortorder
msgid "Classic, legacy order;Alphabetic order (but language still first)"
msgstr ""
#: ulng.rsoptdifferframeposition
msgid "Active frame panel on left, inactive on right (legacy);Left frame panel on left, right on right"
msgstr ""
#: ulng.rsoptdisable
msgid "Disable"
msgstr ""
#: ulng.rsoptenable
msgid "Enable"
msgstr ""
#: ulng.rsoptenterext
msgid "Enter extension"
msgstr ""
#: ulng.rsoptfavoritetabswheretoaddinlist
msgid "Add at beginning;Add at the end;Alphabetical sort"
msgstr ""
#: ulng.rsoptfileoperationsprogresskind
msgid "separate window;minimized separate window;operations panel"
msgstr ""
#: ulng.rsoptfilesizeformat
msgid "float;B;K;M;G"
msgstr ""
#: ulng.rsopthotkeysadddeleteshortcutlong
msgid "Shortcut %s for cm_Delete will be registered, so it can be used to reverse this setting."
msgstr ""
#: ulng.rsopthotkeysaddhotkey
msgid "Add hotkey for %s"
msgstr ""
#: ulng.rsopthotkeysaddshortcutbutton
msgid "Add shortcut"
msgstr ""
#: ulng.rsopthotkeyscannotsetshortcut
msgid "Cannot set shortcut"
msgstr ""
#: ulng.rsopthotkeyschangeshortcut
msgid "Change shortcut"
msgstr ""
#: ulng.rsopthotkeyscommand
msgctxt "ulng.rsopthotkeyscommand"
msgid "Command"
msgstr ""
#: ulng.rsopthotkeysdeletetrashcanoverrides
msgid "Shortcut %s for cm_Delete has a parameter that overrides this setting. Do you want to change this parameter to use the global setting?"
msgstr ""
#: ulng.rsopthotkeysdeletetrashcanparameterexists
msgid "Shortcut %s for cm_Delete needs to have a parameter changed to match shortcut %s. Do you want to change it?"
msgstr ""
#: ulng.rsopthotkeysdescription
msgctxt "ulng.rsopthotkeysdescription"
msgid "Description"
msgstr ""
#: ulng.rsopthotkeysedithotkey
msgid "Edit hotkey for %s"
msgstr ""
#: ulng.rsopthotkeysfixparameter
msgid "Fix parameter"
msgstr ""
#: ulng.rsopthotkeyshotkey
msgctxt "ulng.rsopthotkeyshotkey"
msgid "Hotkey"
msgstr ""
#: ulng.rsopthotkeyshotkeys
msgctxt "ulng.rsopthotkeyshotkeys"
msgid "Hotkeys"
msgstr ""
#: ulng.rsopthotkeysnohotkey
msgid "<none>"
msgstr ""
#: ulng.rsopthotkeysparameters
msgctxt "ulng.rsopthotkeysparameters"
msgid "Parameters"
msgstr ""
#: ulng.rsopthotkeyssetdeleteshortcut
msgid "Set shortcut to delete file"
msgstr ""
#: ulng.rsopthotkeysshortcutfordeletealreadyassigned
msgid "For this setting to work with shortcut %s, shortcut %s must be assigned to cm_Delete but it is already assigned to %s. Do you want to change it?"
msgstr ""
#: ulng.rsopthotkeysshortcutfordeleteissequence
msgid "Shortcut %s for cm_Delete is a sequence shortcut for which a hotkey with reversed Shift cannot be assigned. This setting might not work."
msgstr ""
#: ulng.rsopthotkeysshortcutused
msgid "Shortcut in use"
msgstr ""
#: ulng.rsopthotkeysshortcutusedtext1
msgid "Shortcut %s is already used."
msgstr ""
#: ulng.rsopthotkeysshortcutusedtext2
msgid "Change it to %s?"
msgstr ""
#: ulng.rsopthotkeysusedby
msgid "used for %s in %s"
msgstr ""
#: ulng.rsopthotkeysusedwithdifferentparams
msgid "used for this command but with different parameters"
msgstr ""
#: ulng.rsoptionseditorarchivers
msgid "Archivers"
msgstr ""
#: ulng.rsoptionseditorautorefresh
msgid "Auto refresh"
msgstr ""
#: ulng.rsoptionseditorbehavior
msgid "Behaviors"
msgstr ""
#: ulng.rsoptionseditorbriefview
msgid "Brief"
msgstr ""
#: ulng.rsoptionseditorcolors
msgid "Colors"
msgstr ""
#: ulng.rsoptionseditorcolumnsview
msgid "Columns"
msgstr ""
#: ulng.rsoptionseditorconfiguration
msgctxt "ulng.rsoptionseditorconfiguration"
msgid "Configuration"
msgstr ""
#: ulng.rsoptionseditorcustomcolumns
msgid "Custom columns"
msgstr ""
#: ulng.rsoptionseditordirectoryhotlist
msgctxt "ulng.rsoptionseditordirectoryhotlist"
msgid "Directory Hotlist"
msgstr ""
#: ulng.rsoptionseditordraganddrop
msgid "Drag & drop"
msgstr ""
#: ulng.rsoptionseditordriveslistbutton
msgid "Drives list button"
msgstr ""
#: ulng.rsoptionseditorfavoritetabs
msgid "Favorite Tabs"
msgstr ""
#: ulng.rsoptionseditorfileassicextra
msgid "File associations extra"
msgstr ""
#: ulng.rsoptionseditorfileassoc
msgid "File associations"
msgstr ""
#: ulng.rsoptionseditorfilenewfiletypes
msgctxt "ulng.rsoptionseditorfilenewfiletypes"
msgid "New"
msgstr ""
#: ulng.rsoptionseditorfileoperations
msgid "File operations"
msgstr ""
#: ulng.rsoptionseditorfilepanels
msgid "File panels"
msgstr ""
#: ulng.rsoptionseditorfilesearch
msgctxt "ulng.rsoptionseditorfilesearch"
msgid "File search"
msgstr ""
#: ulng.rsoptionseditorfilesviews
msgid "Files views"
msgstr ""
#: ulng.rsoptionseditorfiletypes
msgctxt "ulng.rsoptionseditorfiletypes"
msgid "File types"
msgstr ""
#: ulng.rsoptionseditorfoldertabs
msgid "Folder tabs"
msgstr ""
#: ulng.rsoptionseditorfoldertabsextra
msgid "Folder tabs extra"
msgstr ""
#: ulng.rsoptionseditorfonts
msgid "Fonts"
msgstr ""
#: ulng.rsoptionseditorhighlighters
msgid "Highlighters"
msgstr ""
#: ulng.rsoptionseditorhotkeys
msgid "Hot keys"
msgstr ""
#: ulng.rsoptionseditoricons
msgid "Icons"
msgstr ""
#: ulng.rsoptionseditorignorelist
msgid "Ignore list"
msgstr ""
#: ulng.rsoptionseditorkeyboard
msgid "Keys"
msgstr ""
#: ulng.rsoptionseditorlanguage
msgid "Language"
msgstr ""
#: ulng.rsoptionseditorlayout
msgid "Layout"
msgstr ""
#: ulng.rsoptionseditorlog
msgid "Log"
msgstr ""
#: ulng.rsoptionseditormiscellaneous
msgid "Miscellaneous"
msgstr ""
#: ulng.rsoptionseditormouse
msgid "Mouse"
msgstr ""
#: ulng.rsoptionseditoroptionschanged
msgid ""
"Options have changed in \"%s\"\n"
"\n"
"Do you want to save modifications?\n"
msgstr ""
#: ulng.rsoptionseditorplugins
msgctxt "ulng.rsoptionseditorplugins"
msgid "Plugins"
msgstr ""
#: ulng.rsoptionseditorquicksearch
msgid "Quick search/filter"
msgstr ""
#: ulng.rsoptionseditorterminal
msgctxt "ulng.rsoptionseditorterminal"
msgid "Terminal"
msgstr ""
#: ulng.rsoptionseditortoolbar
msgid "Toolbar"
msgstr ""
#: ulng.rsoptionseditortools
msgid "Tools"
msgstr ""
#: ulng.rsoptionseditortooltips
msgid "Tooltips"
msgstr ""
#: ulng.rsoptionseditortreeviewmenu
msgctxt "ulng.rsoptionseditortreeviewmenu"
msgid "Tree View Menu"
msgstr ""
#: ulng.rsoptionseditortreeviewmenucolors
msgid "Tree View Menu Colors"
msgstr ""
#: ulng.rsoptletters
msgid "None;Command Line;Quick Search;Quick Filter"
msgstr ""
#: ulng.rsoptmouseselectionbutton
msgid "Left button;Right button;"
msgstr ""
#: ulng.rsoptnewfilesposition
msgid "at the top of the file list;after directories (if directories are sorted before files);at sorted position;at the bottom of the file list"
msgstr ""
#: ulng.rsoptpluginalreadyassigned
msgid "Plugin %s is already assigned for the following extensions:"
msgstr ""
#: ulng.rsoptpluginsactive
msgctxt "ulng.rsoptpluginsactive"
msgid "Active"
msgstr ""
#: ulng.rsoptpluginsfilename
msgctxt "ulng.rsoptpluginsfilename"
msgid "File name"
msgstr ""
#: ulng.rsoptpluginsname
msgctxt "ulng.rsoptpluginsname"
msgid "Name"
msgstr ""
#: ulng.rsoptpluginsregisteredfor
msgctxt "ulng.rsoptpluginsregisteredfor"
msgid "Registered for"
msgstr ""
#: ulng.rsoptsearchcase
msgid "&Sensitive;&Insensitive"
msgstr ""
#: ulng.rsoptsearchitems
msgid "&Files;Di&rectories;Files a&nd Directories"
msgstr ""
#: ulng.rsoptsearchopt
msgid "&Hide filter panel when not focused;Keep saving setting modifications for next session"
msgstr ""
#: ulng.rsoptsortcasesens
msgid "not case sensitive;according to locale settings (aAbBcC);first upper then lower case (ABCabc)"
msgstr ""
#: ulng.rsoptsortfoldermode
msgid "sort by name and show first;sort like files and show first;sort like files"
msgstr ""
#: ulng.rsoptsortmethod
msgid "Alphabetical, considering accents;Natural sorting: alphabetical and numbers"
msgstr ""
#: ulng.rsopttabsposition
msgid "Top;Bottom;"
msgstr ""
#: ulng.rsopttoolbarbuttontype
msgid "S&eparator;Inte&rnal command;E&xternal command;Men&u"
msgstr ""
#: ulng.rsopttypeofduplicatedrename
msgid "DC legacy - Copy (x) filename.ext;Windows - filename (x).ext;Other - filename(x).ext"
msgstr ""
#: ulng.rsoptupdatedfilesposition
msgid "don't change position;use the same setting as for new files;to sorted position"
msgstr ""
#: ulng.rspropscontains
msgid "Files: %d, folders: %d"
msgstr ""
#: ulng.rspropserrchmod
msgid "Can not change access rights for \"%s\""
msgstr ""
#: ulng.rspropserrchown
msgid "Can not change owner for \"%s\""
msgstr ""
#: ulng.rspropsfile
msgid "File"
msgstr ""
#: ulng.rspropsfolder
msgctxt "ulng.rspropsfolder"
msgid "Directory"
msgstr ""
#: ulng.rspropsnmdpipe
msgid "Named pipe"
msgstr ""
#: ulng.rspropssocket
msgid "Socket"
msgstr ""
#: ulng.rspropsspblkdev
msgid "Special block device"
msgstr ""
#: ulng.rspropsspchrdev
msgid "Special character device"
msgstr ""
#: ulng.rspropssymlink
msgid "Symbolic link"
msgstr ""
#: ulng.rspropsunknowntype
msgid "Unknown type"
msgstr ""
#: ulng.rssearchresult
msgid "Search result"
msgstr ""
#: ulng.rssearchstatus
msgid "SEARCH"
msgstr ""
#: ulng.rssearchtemplateunnamed
msgid "<unnamed template>"
msgstr ""
#: ulng.rssearchwithdsxplugininprogress
msgid ""
"A file search using DSX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rssearchwithwdxplugininprogress
msgid ""
"A file search using WDX plugin is already in progress.\n"
"We need that one to be completed before to launch a new one.\n"
msgstr ""
#: ulng.rsselectdir
msgid "Select a directory"
msgstr ""
#: ulng.rsselectyoufindfileswindow
msgid "Select your window"
msgstr ""
#: ulng.rsshowhelpfor
msgid "&Show help for %s"
msgstr ""
#: ulng.rssimplewordall
msgctxt "ulng.rssimplewordall"
msgid "All"
msgstr ""
#: ulng.rssimplewordcategory
msgctxt "ulng.rssimplewordcategory"
msgid "Category"
msgstr ""
#: ulng.rssimplewordcolumnsingular
msgid "Column"
msgstr ""
#: ulng.rssimplewordcommand
msgctxt "ulng.rssimplewordcommand"
msgid "Command"
msgstr ""
#: ulng.rssimplewordfilename
msgid "Filename"
msgstr ""
#: ulng.rssimplewordfiles
msgid "files"
msgstr ""
#: ulng.rssimplewordletter
msgid "Letter"
msgstr ""
#: ulng.rssimplewordparameter
msgid "Param"
msgstr ""
#: ulng.rssimplewordresult
msgid "Result"
msgstr ""
#: ulng.rssimplewordworkdir
msgid "WorkDir"
msgstr ""
#: ulng.rssizeunitbytes
msgid "Bytes"
msgstr ""
#: ulng.rssizeunitgbytes
msgid "Gigabytes"
msgstr ""
#: ulng.rssizeunitkbytes
msgid "Kilobytes"
msgstr ""
#: ulng.rssizeunitmbytes
msgid "Megabytes"
msgstr ""
#: ulng.rssizeunittbytes
msgid "Terabytes"
msgstr ""
#: ulng.rsspacemsg
msgid "Files: %d, Dirs: %d, Size: %s (%s bytes)"
msgstr ""
#: ulng.rsspliterrdirectory
msgid "Unable to create target directory!"
msgstr ""
#: ulng.rsspliterrfilesize
msgid "Incorrect file size format!"
msgstr ""
#: ulng.rsspliterrsplitfile
msgid "Unable to split the file!"
msgstr ""
#: ulng.rssplitmsgmanyparts
msgid "The number of parts is more than 100! Continue?"
msgstr ""
#: ulng.rssplitpredefinedsizes
msgid "Automatic;1457664B - 3.5\" High Density 1.44M;1213952B - 5.25\" High Density 1.2M;730112B - 3.5\" Double Density 720K;362496B - 5.25\" Double Density 360K;98078KB - ZIP 100MB;650MB - CD 650MB;700MB - CD 700MB;4482MB - DVD+R"
msgstr ""
#: ulng.rssplitseldir
msgid "Select directory:"
msgstr ""
#: ulng.rsstraccents
msgid "á;â;à;å;ã;ä;ç;é;ê;è;ë;í;î;ì;ï;ñ;ó;ô;ò;ø;õ;ö;ú;û;ù;ü;ÿ;Á;Â;À;Å;Ã;Ä;Ç;É;Ê;È;Ë;Í;Í;Ì;Ï;Ñ;Ó;Ô;Ø;Õ;Ö;ß;Ú;Û;Ù;Ü;Ÿ;¿;¡;œ;æ;Æ;Œ"
msgstr ""
#: ulng.rsstraccentsstripped
msgid "a;a;a;a;a;a;c;e;e;e;e;i;i;i;i;n;o;o;o;o;o;o;u;u;u;u;y;A;A;A;A;A;A;C;E;E;E;E;I;I;I;I;N;O;O;O;O;O;B;U;U;U;U;Y;?;!;oe;ae;AE;OE"
msgstr ""
#: ulng.rsstrpreviewjustpreview
msgid "Just preview"
msgstr ""
#: ulng.rsstrpreviewothers
msgid "Others"
msgstr ""
#: ulng.rsstrpreviewsearchingletters
msgid "OU"
msgstr ""
#: ulng.rsstrpreviewsidenote
msgid "Side note"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched1
msgid "Flat"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched2
msgid "Limited"
msgstr ""
#: ulng.rsstrpreviewwordwithoutsearched3
msgid "Simple"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched1
msgid "Fabulous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched2
msgid "Marvelous"
msgstr ""
#: ulng.rsstrpreviewwordwithsearched3
msgid "Tremendous"
msgstr ""
#: ulng.rsstrtvmchoosedirhistory
msgid "Choose your directory from Dir History"
msgstr ""
#: ulng.rsstrtvmchoosefavoritetabs
msgid "Choose you Favorite Tabs:"
msgstr ""
#: ulng.rsstrtvmchoosefromcmdlinehistory
msgid "Choose your command from Command Line History"
msgstr ""
#: ulng.rsstrtvmchoosefrommainmenu
msgid "Choose your action from Main Menu"
msgstr ""
#: ulng.rsstrtvmchoosefromtoolbar
msgid "Choose your action from Maintool bar"
msgstr ""
#: ulng.rsstrtvmchoosehotdirectory
msgid "Choose your directory from Hot Directory:"
msgstr ""
#: ulng.rsstrtvmchooseviewhistory
msgid "Choose your directory from File View History"
msgstr ""
#: ulng.rsstrtvmchooseyourfileordir
msgid "Choose your file or your directory"
msgstr ""
#: ulng.rssymerrcreate
msgid "Error creating symlink."
msgstr ""
#: ulng.rssyndefaulttext
msgid "Default text"
msgstr ""
#: ulng.rssynlangplaintext
msgid "Plain text"
msgstr ""
#: ulng.rstabsactionondoubleclickchoices
msgid "Do nothing;Close tab;Access Favorite Tabs;Tabs popup menu"
msgstr ""
#: ulng.rstimeunitday
msgid "Day(s)"
msgstr ""
#: ulng.rstimeunithour
msgid "Hour(s)"
msgstr ""
#: ulng.rstimeunitminute
msgid "Minute(s)"
msgstr ""
#: ulng.rstimeunitmonth
msgid "Month(s)"
msgstr ""
#: ulng.rstimeunitsecond
msgid "Second(s)"
msgstr ""
#: ulng.rstimeunitweek
msgid "Week(s)"
msgstr ""
#: ulng.rstimeunityear
msgid "Year(s)"
msgstr ""
#: ulng.rstitlerenamefavtabs
msgid "Rename Favorite Tabs"
msgstr ""
#: ulng.rstitlerenamefavtabsmenu
msgid "Rename Favorite Tabs sub-menu"
msgstr ""
#: ulng.rstooldiffer
msgctxt "ulng.rstooldiffer"
msgid "Differ"
msgstr ""
#: ulng.rstooleditor
msgctxt "ulng.rstooleditor"
msgid "Editor"
msgstr ""
#: ulng.rstoolerroropeningdiffer
msgid "Error opening differ"
msgstr ""
#: ulng.rstoolerroropeningeditor
msgid "Error opening editor"
msgstr ""
#: ulng.rstoolerroropeningterminal
msgid "Error opening terminal"
msgstr ""
#: ulng.rstoolerroropeningviewer
msgid "Error opening viewer"
msgstr ""
#: ulng.rstoolterminal
msgctxt "ulng.rstoolterminal"
msgid "Terminal"
msgstr ""
#: ulng.rstoolviewer
msgctxt "ulng.rstoolviewer"
msgid "Viewer"
msgstr ""
#: ulng.rsunhandledexceptionmessage
msgid "Please report this error to the bug tracker with a description of what you were doing and the following file:%sPress %s to continue or %s to abort the program."
msgstr ""
#: ulng.rsvarbothpanelactivetoinactive
msgid "Both panels, from active to inactive"
msgstr ""
#: ulng.rsvarbothpanellefttoright
msgid "Both panels, from left to right"
msgstr ""
#: ulng.rsvarcurrentpath
msgid "Path of panel"
msgstr ""
#: ulng.rsvarencloseelement
msgid "Enclose each name in brackets or what you want"
msgstr ""
#: ulng.rsvarfilenamenoext
msgid "Just filename, no extension"
msgstr ""
#: ulng.rsvarfullpath
msgid "Complete filename (path+filename)"
msgstr ""
#: ulng.rsvarhelpwith
msgid "Help with \"%\" variables"
msgstr ""
#: ulng.rsvarinputparam
msgid "Will request request user to enter a parameter with a default suggested value"
msgstr ""
#: ulng.rsvarleftpanel
msgid "Left panel"
msgstr ""
#: ulng.rsvarlistfilename
msgid "Temporary filename of list of filenames"
msgstr ""
#: ulng.rsvarlistfullfilename
msgid "Temporary filename of list of complete filenames (path+filename)"
msgstr ""
#: ulng.rsvarlistinutf16
msgid "Filenames in list in UTF-16 with BOM"
msgstr ""
#: ulng.rsvarlistinutf16quoted
msgid "Filenames in list in UTF-16 with BOM, inside double quotes"
msgstr ""
#: ulng.rsvarlistinutf8
msgid "Filenames in list in UTF-8"
msgstr ""
#: ulng.rsvarlistinutf8quoted
msgid "Filenames in list in UTF-8, inside double quotes"
msgstr ""
#: ulng.rsvarlistrelativefilename
msgid "Temporary filename of list of filenames with relative path"
msgstr ""
#: ulng.rsvaronlyextension
msgid "Only file extension"
msgstr ""
#: ulng.rsvaronlyfilename
msgid "Only filename"
msgstr ""
#: ulng.rsvarotherexamples
msgid "Other example of what's possible"
msgstr ""
#: ulng.rsvarpath
msgid "Path, with ending delimiter"
msgstr ""
#: ulng.rsvarpercentchangetopound
msgid "From here to the end of the line, the percent-variable indicator is the \"#\" sign"
msgstr ""
#: ulng.rsvarpercentsign
msgid "Return the percent sign"
msgstr ""
#: ulng.rsvarpoundchangetopercent
msgid "From here to the end of the line, the percent-variable indicator is back the \"%\" sign"
msgstr ""
#: ulng.rsvarprependelement
msgid "Prepend each name with \"-a \" or what you want"
msgstr ""
#: ulng.rsvarpromptuserforparam
msgid "%[Prompt user for param;Default value proposed]"
msgstr ""
#: ulng.rsvarrelativepathandfilename
msgid "Filename with relative path"
msgstr ""
#: ulng.rsvarrightpanel
msgid "Right panel"
msgstr ""
#: ulng.rsvarsecondelementrightpanel
msgid "Full path of second selected file in right panel"
msgstr ""
#: ulng.rsvarshowcommandprior
msgid "Show command prior execute"
msgstr ""
#: ulng.rsvarsimplemessage
msgid "%[Simple message]"
msgstr ""
#: ulng.rsvarsimpleshowmessage
msgid "Will show a simple message"
msgstr ""
#: ulng.rsvarsourcepanel
msgid "Active panel (source)"
msgstr ""
#: ulng.rsvartargetpanel
msgid "Inactive panel (target)"
msgstr ""
#: ulng.rsvarwillbequoted
msgid "Filenames will be quoted from here (default)"
msgstr ""
#: ulng.rsvarwilldointerminal
msgid "Command will be done in terminal, remaining opened at the end"
msgstr ""
#: ulng.rsvarwillhaveendingdelimiter
msgid "Paths will have ending delimiter"
msgstr ""
#: ulng.rsvarwillnotbequoted
msgid "Filenames will not be quoted from here"
msgstr ""
#: ulng.rsvarwillnotdointerminal
msgid "Command will be done in terminal, closed at the end"
msgstr ""
#: ulng.rsvarwillnothaveendingdelimiter
msgid "Paths will not have ending delimiter (default)"
msgstr ""
#: ulng.rsvfsnetwork
msgctxt "ulng.rsvfsnetwork"
msgid "Network"
msgstr ""
#: ulng.rsviewabouttext
msgid "Internal Viewer of Double Commander."
msgstr ""
#: ulng.rsviewbadquality
msgid "Bad Quality"
msgstr ""
#: ulng.rsviewencoding
msgctxt "ulng.rsviewencoding"
msgid "Encoding"
msgstr ""
#: ulng.rsviewimagetype
msgid "Image Type"
msgstr ""
#: ulng.rsviewnewsize
msgctxt "ulng.rsviewnewsize"
msgid "New Size"
msgstr ""
#: ulng.rsviewnotfound
msgid "%s not found!"
msgstr ""
#: ulng.rsviewwithexternalviewer
msgid "with external viewer"
msgstr ""
#: ulng.rsviewwithinternalviewer
msgid "with internal viewer"
msgstr ""
#: ulng.rsxreplacements
msgid "Number of replacement: %d"
msgstr ""
#: ulng.rszeroreplacement
msgid "No replacement took place."
msgstr ""